Property Summary

NCBI Gene PubMed Count 14
PubMed Score 83.76
PubTator Score 25.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.785 1.1e-08
diabetes mellitus -1.200 5.2e-03
glioblastoma 1.100 9.3e-07
group 3 medulloblastoma 1.100 1.2e-03
juvenile dermatomyositis 1.448 3.4e-13
medulloblastoma, large-cell 1.300 7.0e-05
ovarian cancer 1.600 1.1e-04
pediatric high grade glioma 1.200 9.7e-05
primitive neuroectodermal tumor 1.100 1.7e-04

Gene RIF (7)

AA Sequence

MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGT      1 - 70
VTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQ     71 - 140
PSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVL    141 - 210
RKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTP    211 - 280
THSRKKRRRSSNQ                                                             281 - 293
//

Text Mined References (27)

PMID Year Title