Property Summary

NCBI Gene PubMed Count 13
PubMed Score 84.76
PubTator Score 25.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.38851796806292E-13
acute quadriplegic myopathy 1157 1.0696126424618E-8
ovarian cancer 8492 9.426618690858E-6
glioblastoma 5572 1.65909161930378E-5
sonic hedgehog group medulloblastoma 1482 6.66067075159638E-5
medulloblastoma, large-cell 6234 6.95382231141338E-5
pediatric high grade glioma 2712 9.68411506292701E-5
primitive neuroectodermal tumor 3031 1.68547185631464E-4
diabetes mellitus 1663 0.00518850772860051
Disease Target Count Z-score Confidence
Megaloblastic anemia 18 4.753 2.4

Expression

  Differential Expression (9)

Synonym

Accession Q9BYG3 A8K788 Q8TB66 Q96ED4
Symbols Nopp34
MKI67IP

Gene

PDB

2AFF  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
25826659 The RNA recognition motif of NIFK is required for rRNA maturation during cell cycle progression.
24690621 Tandem affinity purification and mass spectrometry analysis identify Nopp34 associated HIV-1 Gag in 293T cells
22944692 Tandem affinity purification and mass spectrometry analysis identify Nopp34 associated HIV-1 Gag in 293T cells
21539773 Potential encounter complexes of the Ki67FHA receptor and hNIFK peptide are misregistered states of the beta-sheet.
17891046 Better basal gene expression was observed by co-cultured respiratory epithelial cells compared to dispase dissociated cells.
14659764 nmr analysis of the solution structure of the FHA domain of human Ki67 and mapping of the binding surface for NIFK binding

AA Sequence

MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGT      1 - 70
VTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQ     71 - 140
PSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVL    141 - 210
RKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTP    211 - 280
THSRKKRRRSSNQ                                                             281 - 293
//

Text Mined References (25)

PMID Year Title
25826659 2015 The RNA recognition motif of NIFK is required for rRNA maturation during cell cycle progression.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21539773 2011 Direct observations of shifts in the ?-sheet register of a protein-peptide complex using explicit solvent simulations.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...