Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.69
PubTator Score 7.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.71940587756962E-17
breast carcinoma 1614 1.81386698308767E-13
juvenile dermatomyositis 1189 4.81928378346657E-13
pediatric high grade glioma 2712 6.55786781857249E-8
primitive neuroectodermal tumor 3031 1.86708621462051E-7
atypical teratoid/rhabdoid tumor 1095 2.64426835633796E-7
cystic fibrosis 1670 2.70798773514065E-7
Breast cancer 3099 6.35172346916842E-7
pilocytic astrocytoma 3086 3.07127603394303E-6
glioblastoma 5572 3.72408121257885E-6
pituitary cancer 1972 7.4795059773108E-6
non-small cell lung cancer 2798 4.62810783687316E-5
osteosarcoma 7933 5.54549384502642E-5
sonic hedgehog group medulloblastoma 1482 8.06211556530723E-5
medulloblastoma, large-cell 6234 1.81852213170092E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.010998011041273
pancreatic cancer 2300 0.013177059814789
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0133637410122473
tuberculosis 1563 0.0148687299417228
chronic rhinosinusitis 512 0.0348402687563878
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0494579947315792
Disease Target Count Z-score Confidence
Hypopharynx cancer 3 3.47 1.7

Expression

Synonym

Accession Q9BYG0 D3DNS5 Q59FE3 Q7L9Z5 Q8WWP9
Symbols B3GN-T5
beta3Gn-T5

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
22411838 bone marrow samples of acute myeloid leukemia patients had 16-fold higher expression of B3GNT5 than those of healthy donors
20734064 Observational study of gene-disease association. (HuGE Navigator)
18483624 Helicobacter pylori induces beta3GnT5 in human gastric cell lines, modulating expression of the SabA ligand sialyl-Lewis x

AA Sequence

MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVNDTLSLKHTSAG      1 - 70
PRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGE     71 - 140
ELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSL    141 - 210
EQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLY    211 - 280
IDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFG    281 - 350
QIYCRLMKIILLCKISYVDTYPCRAAFI                                              351 - 378
//

Text Mined References (10)

PMID Year Title
22411838 2012 High expression of lactotriaosylceramide, a differentiation-associated glycosphingolipid, in the bone marrow of acute myeloid leukemia patients.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
18483624 2008 Helicobacter pylori induces beta3GnT5 in human gastric cell lines, modulating expression of the SabA ligand sialyl-Lewis x.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11384981 2001 Cloning of a mouse beta 1,3 N-acetylglucosaminyltransferase GlcNAc(beta 1,3)Gal(beta 1,4)Glc-ceramide synthase gene encoding the key regulator of lacto-series glycolipid biosynthesis.
11283017 2001 Molecular cloning and characterization of UDP-GlcNAc:lactosylceramide beta 1,3-N-acetylglucosaminyltransferase (beta 3Gn-T5), an essential enzyme for the expression of HNK-1 and Lewis X epitopes on glycolipids.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.