Property Summary

Ligand Count 55
NCBI Gene PubMed Count 233
PubMed Score 1129.29
PubTator Score 481.56

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
active Crohn's disease 1.366 4.4e-02
active ulcerative colitis 1.415 1.3e-02
cutaneous lupus erythematosus 1.600 4.3e-03
cystic fibrosis 1.300 3.2e-03
nephrosclerosis -1.817 4.4e-02
psoriasis 1.400 1.0e-36
urothelial carcinoma -1.600 5.5e-06


Accession Q9BYF1 C7ECU1 Q6UWP0 Q86WT0 Q9NRA7 Q9UFZ6
Symbols ACEH


PANTHER Protein Class (3)

PDB (12)

Gene RIF (226)

AA Sequence

KNKARSGENPYASIDISKGENNPGFQNTDDVQTSF                                       771 - 805

Text Mined References (236)

PMID Year Title