Property Summary

NCBI Gene PubMed Count 216
PubMed Score 1065.52
PubTator Score 481.56

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
nephrosclerosis -1.984 0.018
urothelial carcinoma -1.600 0.000
cutaneous lupus erythematosus 1.600 0.004
active Crohn's disease 1.366 0.044
active ulcerative colitis 1.415 0.013
cystic fibrosis 1.300 0.003
psoriasis 1.400 0.000


Accession Q9BYF1 C7ECU1 Q6UWP0 Q86WT0 Q9NRA7 Q9UFZ6
Symbols ACEH



1R42   1R4L   1XJP   2AJF   3D0G   3D0H   3D0I   3KBH   3SCI   3SCJ   3SCK   3SCL  

  Ortholog (15)

Gene RIF (210)

26067610 Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels.
25869724 ACE and ACE2 expression at the mRNA and protein levels are significantly increased in the myocardium of patients with heart failure.
25815490 There is no clear association between ACE2 gene A9570G polymorphisms and childhood primary nephrotic syndrome.
25813276 Decrease in circulating ACE2 activity was associated with cardiovascular disease in patients with chronic kidney disease.
25791940 urinary ACE2 increased in type 2 diabetic patients with various degrees of albuminuria
25721616 ACE2 and Ang-(1-7) significantly inhibit early atherosclerotic lesion formation via protection of endothelial function and inhibition of inflammatory response.
25701390 Hepatocellular carcinoma patients with higher level of ACE2 expression had longer survival time than those with lower level of ACE2 expression.
25665060 ACE-2 is expressed in fetal human lung fibroblasts but is significantly decreased by hyperoxic gas
25663464 By genetic replenishment of ACE2 and pharmaceutical use of ARB, restored ACE2 level mitigated GBC growth. Our results supported the rationale for the use of ARB in GBC patients for potential therapeutic benefit
25534429 SIT1, B(0)AT1 and ACE2 were co-localized in the brush-border membrane of small intestine enterocytes.

AA Sequence

KNKARSGENPYASIDISKGENNPGFQNTDDVQTSF                                       771 - 805

Text Mined References (219)

PMID Year Title
26067610 2015 Urinary ACE2 is associated with urinary L-FABP and albuminuria in patients with chronic kidney disease.
25869724 2015 Balance between angiotensin converting enzyme and angiotensin converting enzyme 2 in patients with chronic heart failure.
25815490 2015 [Association between angiotensin-converting enzyme 2 gene polymorphisms and childhood primary nephrotic syndrome].
25813276 2015 Circulating angiotensin-converting enzyme 2 activity in patients with chronic kidney disease without previous history of cardiovascular disease.
25791940 2015 Urinary angiotensin converting enzyme 2 increases in patients with type 2 diabetic mellitus.
25721616 2015 ACE2 and Ang-(1-7) protect endothelial cell function and prevent early atherosclerosis by inhibiting inflammatory response.
25701390 2015 The association of renin-angiotensin system genes with the progression of hepatocellular carcinoma.
25665060 2015 Hyperoxia downregulates angiotensin-converting enzyme-2 in human fetal lung fibroblasts.
25663464 2015 Loss of angiotensin-converting enzyme 2 promotes growth of gallbladder cancer.
25534429 2015 Human intestine luminal ACE2 and amino acid transporter expression increased by ACE-inhibitors.