Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 4
Funding $712,929.5
PubMed Score 6.09
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 0.000
active Crohn's disease -1.301 0.026

Synonym

Accession Q9BYE9 A1L3U4 A6NC80 Q9NXP8
Symbols PCLKC
PCDH24

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24725409 Study found that brush border assembly is driven by the formation of Ca(2+)-dependent adhesion links between adjacent microvilli. Intermicrovillar links are composed of protocadherin-24 and mucin-like protocadherin, which target to microvillar tips and interact to form a trans-heterophilic complex.
22628312 CDHR24 is directly involved in cell and tissue morphogenesis
19383367 suppression of beta-catenin signaling by PCDH24 leads to contact inhibition

AA Sequence

MAQLWLSCFLLPALVVSVAANVAPKFLANMTSVILPEDLPVGAQAFWLVAEDQDNDPLTYGMSGPNAYFF      1 - 70
AVTPKTGEVKLASALDYETLYTFKVTISVSDPYIQVQREMLVIVEDRNDNAPVFQNTAFSTSINETLPVG     71 - 140
SVVFSVLAVDKDMGSAGMVVYSIEKVIPSTGDSEHLFRILANGSIVLNGSLSYNNKSAFYQLELKACDLG    141 - 210
GMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSI    211 - 280
SYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQVTATETHLNIYGQEAKVSIWVTVRVMDVNDHK    281 - 350
PEFYNCSLPACTFTPEEAQVNFTGYVDEHASPRIPIDDLTMVVYDPDKGSNGTFLLSLGGPDAEAFSVSP    351 - 420
ERAVGSASVQVLVRVSALVDYERQTAMAVQVVATDSVSQNFSVAMVTIHLRDINDHRPTFPQSLYVLTVP    421 - 490
EHSATGSVVTDSIHATDPDTGAWGQITYSLLPGNGADLFQVDPVSGTVTVRNGELLDRESQAVYYLTLQA    491 - 560
TDGGNLSSSTTLQIHLLDINDNAPVVSGSYNIFVQEEEGNVSVTIQAHDNDEPGTNNSRLLFNLLPGPYS    561 - 630
HNFSLDPDTGLLRNLGPLDREAIDPALEGRIVLTVLVSDCGEPVLGTKVNVTITVEDINDNLPIFNQSSY    631 - 700
NFTVKEEDPGVLVGVVKAWDADQTEANNRISFSLSGSGANYFMIRGLVLGAGWAEGYLRLPPDVSLDYET    701 - 770
QPVFNLTVSAENPDPQGGETIVDVCVNVKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVVASDVDTSA    771 - 840
QLEIQLVNILCTKAGVDVGSLCWGWFSVAANGSVYINQSKAIDYEACDLVTLVVRACDLATDPGFQAYSN    841 - 910
NGSLLITIEDVNDNAPYFLPENKTFVIIPELVLPNREVASVRARDDDSGNNGVILFSILRVDFISKDGAT    911 - 980
IPFQGVFSIFTSSEADVFAGSIQPVTSLDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSR    981 - 1050
LQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMI   1051 - 1120
RNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISVIIGLGVALLLVLVIMTMAFVCVRKSYNRKLQAMKA   1121 - 1190
AKEARKTAAGVMPSAPAIPGTNMYNTERANPMLNLPNKDLGLEYLSPSNDLDSVSVNSLDDNSVDVDKNS   1191 - 1260
QEIKEHRPPHTPPEPDPEPLSVVLLGRQAGASGQLEGPSYTNAGLDTTDL                       1261 - 1310
//

Text Mined References (21)

PMID Year Title
26812018 2016 ANKS4B Is Essential for Intermicrovillar Adhesion Complex Formation.
26812017 2016 Mechanistic Basis of Organization of the Harmonin/USH1C-Mediated Brush Border Microvilli Tip-Link Complex.
24725409 2014 Intestinal brush border assembly driven by protocadherin-based intermicrovillar adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22628312 2012 Cadherin-related protein 24 induces morphological changes and partial cell polarization by facilitating direct cell-cell interactions.
21330445 2011 Proteomic analysis of the enterocyte brush border.
19383367 2009 PCDH24-induced contact inhibition involves downregulation of beta-catenin signaling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...