Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31
PubTator Score 0.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.102 0.000
diabetes mellitus 1.300 0.001
psoriasis 4.600 0.000

Gene RIF (2)

PMID Text
23404381 High SPRR2G expression is associated with squamous cell carcinomas of the vulva.
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPP      1 - 70
KSK                                                                        71 - 73
//

Text Mined References (8)

PMID Year Title
23404381 2013 Genomic aberration patterns and expression profiles of squamous cell carcinomas of the vulva.
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
9888996 1999 Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.