Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.31
PubTator Score 0.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.3e-41
osteosarcoma 7950 9.2e-09
diabetes mellitus 1728 1.4e-03
Disease Target Count Z-score Confidence
interstitial cystitis 2312 3.388 1.7
Conjunctival disease 1 3.014 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 1.300 1.4e-03
osteosarcoma 2.102 9.2e-09
psoriasis 3.000 3.3e-41

Gene RIF (2)

AA Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQPYPPCQQKYPP      1 - 70
KSK                                                                        71 - 73
//

Text Mined References (8)

PMID Year Title