Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.11
PubTator Score 1.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Gene RIF (4)

PMID Text
21208785 We identified significant combined effects between MHC and LCE, MHC and IL12B on the risk of psoriasis in Chinese population.
19169255 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15854049 paper describing nomenclature changes and expression in range of tissues and in response to UV
11698679 LEP16 is one of a cluster of 16-20 related genes at 1q21 which includes XP5. Proteins incorporate into the cornified envelope of stratified, terminally differentiating epithelia. LEP16 transcripts detected in heart, skin and esophagus.

AA Sequence

MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNS      1 - 70
CDRGSGQQGGGSGCGHGSGGCC                                                     71 - 92
//

Text Mined References (8)

PMID Year Title
21208785 2011 Variants in MHC, LCE and IL12B have epistatic effects on psoriasis risk in Chinese population.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
19169255 2009 Psoriasis genome-wide association study identifies susceptibility variants within LCE gene cluster at 1q21.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15854049 2005 Late cornified envelope family in differentiating epithelia--response to calcium and ultraviolet irradiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698679 2001 Differentially expressed late constituents of the epidermal cornified envelope.