Property Summary

NCBI Gene PubMed Count 9
Grant Count 46
R01 Count 32
Funding $7,338,852.08
PubMed Score 52.14
PubTator Score 34.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
ovarian cancer -1.100 0.000

Gene RIF (4)

PMID Text
25122802 study demonstrates that two cellular serine proteases, DESC1 and MSPL, activate influenza viruses and emerging coronaviruses in cell culture and, because of their expression in human lung tissue, might promote viral spread in the infected host
20977675 results suggest that TMPRSS13 functions as an HGF-converting protease, the activity of which may be regulated by HAI-1
20219906 The authors report that serine proteases, MSPL and its splice variant TMPRSS13, are novel candidates for proteases processing HA proteins of highly pathogenic avian influenza (HPAI) viruses.
17981585 cloning of MSPL/TMPRSS13, which may play roles in the proteolytic processing of prohormones, precursors of growth factors, and also play roles in the pathogenicity of many viruses and bacteria in vivo

AA Sequence

MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQASPAGTPPGRAS      1 - 70
PGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVYLVRATPVGAVPIRSSPARSA     71 - 140
PATRATRESPGTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILFQFWQGHTGIRYKEQRESCPKHAVR    141 - 210
CDGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHR    211 - 280
DFANSFSILRYNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHI    281 - 350
CGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRL    351 - 420
SKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYL    421 - 490
TPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEV    491 - 560
RSLQQDTAPSRLGTSSGGDPGGAPRV                                                561 - 586
//

Text Mined References (9)

PMID Year Title
25122802 2014 DESC1 and MSPL activate influenza A viruses and emerging coronaviruses for host cell entry.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
20977675 2010 TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor.
20219906 2010 Novel type II transmembrane serine proteases, MSPL and TMPRSS13, Proteolytically activate membrane fusion activity of the hemagglutinin of highly pathogenic avian influenza viruses and induce their multicycle replication.
17981585 2008 MSPL/TMPRSS13.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11267681 2001 Cloning and expression of novel mosaic serine proteases with and without a transmembrane domain from human lung.