Property Summary

NCBI Gene PubMed Count 10
PubMed Score 56.80
PubTator Score 34.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.1e-06
medulloblastoma, large-cell 6241 1.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.2e-04
ovarian cancer -1.100 2.1e-06

Gene RIF (5)

AA Sequence

MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQASPAGTPPGRAS      1 - 70
PGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVYLVRATPVGAVPIRSSPARSA     71 - 140
PATRATRESPGTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILFQFWQGHTGIRYKEQRESCPKHAVR    141 - 210
CDGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHR    211 - 280
DFANSFSILRYNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHI    281 - 350
CGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDDYDIALMRL    351 - 420
SKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYL    421 - 490
TPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEV    491 - 560
RSLQQDTAPSRLGTSSGGDPGGAPRV                                                561 - 586
//

Text Mined References (10)

PMID Year Title