Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.63
PubTator Score 15.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERS      1 - 70
RVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVDPRP     71 - 140
PAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAP    141 - 210
KAPLPPPPAFWRPWP                                                           211 - 225
//

Text Mined References (15)

PMID Year Title