Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.29
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPV      1 - 70
ERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLA     71 - 140
LFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLSASDRKIVED    141 - 210
IKESFCYVAMNYEEEMAKKPDCLEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIM    211 - 280
KCDTGLRNSFFSNIILAGGSTSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQ    281 - 350
DMWITAAEFKEVGPNIVHQRCF                                                    351 - 372
//

Text Mined References (8)

PMID Year Title
24980573 2014 Identification of a melanoma susceptibility locus and somatic mutation in TET2.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
18692047 2008 Nuclear localization of profilin III-ArpM1 complex in mouse spermiogenesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11750065 2001 Identification of two cDNAs for human actin-related proteins (Arps) that have remarkable similarity to conventional actin.