Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.82
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.7e-54
non-small cell lung cancer 2890 6.4e-11
nasopharyngeal carcinoma 1058 3.0e-04
lung cancer 4740 2.2e-02
spina bifida 1074 4.2e-02
Disease Target Count Z-score Confidence
Alopecia 115 3.29 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -3.200 2.2e-02
nasopharyngeal carcinoma -2.400 3.0e-04
non-small cell lung cancer 1.984 6.4e-11
psoriasis 2.500 1.7e-54
spina bifida -2.221 4.2e-02

Synonym

Accession Q9BYD5 B2R569
Symbols PLAC8L2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLH      1 - 70
SIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE                                 71 - 112
//

Text Mined References (6)

PMID Year Title