Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
ovarian cancer 8492 6.67489879582857E-4
lung cancer 4473 8.77938681345425E-4
group 3 medulloblastoma 2254 0.00124458105089121
Multiple myeloma 1328 0.00138597275025804
colon cancer 1475 0.0376355085765503

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.013 0.001
colon cancer 2.600 0.038
lung cancer 1.600 0.001
group 3 medulloblastoma 1.300 0.001
ovarian cancer 1.900 0.001

Synonym

Accession Q9BYD2 B2RD99 Q5SZR2 Q9BSW8 L9mt
Symbols L9mt

Gene

PDB

3J9M   3J7Y  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPVVTAPGRALLRAGAGRLLRGGVQELLRPRHEGNAPDLACNFSLSQNRGTVIVERWWKVPLAGEGRK      1 - 70
PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLF     71 - 140
EEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPE    141 - 210
EPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI                 211 - 267
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...