Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count P-value
ovarian cancer 8520 6.7e-04
lung cancer 4740 8.8e-04
group 3 medulloblastoma 4104 1.2e-03
Multiple myeloma 1332 1.4e-03
colon cancer 1478 3.8e-02

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 2.600 3.8e-02
group 3 medulloblastoma 1.300 1.2e-03
lung cancer 1.600 8.8e-04
Multiple myeloma 2.013 1.4e-03
ovarian cancer 1.900 6.7e-04

Gene RIF (2)

AA Sequence

MAAPVVTAPGRALLRAGAGRLLRGGVQELLRPRHEGNAPDLACNFSLSQNRGTVIVERWWKVPLAGEGRK      1 - 70
PRLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLF     71 - 140
EEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPE    141 - 210
EPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAMAPTSPQI                 211 - 267
//

Text Mined References (17)

PMID Year Title