Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.05
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.8e-07
psoriasis 6694 3.9e-05
ovarian cancer 8519 1.5e-03
dermatomyositis 966 1.5e-03
breast carcinoma 1637 1.1e-02
acute myeloid leukemia 783 3.6e-02

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.500 3.6e-02
breast carcinoma 1.400 1.1e-02
dermatomyositis 1.600 1.5e-03
osteosarcoma -2.411 2.8e-07
ovarian cancer 1.700 1.5e-03
psoriasis -2.900 3.9e-05

Gene RIF (1)

AA Sequence

MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWIN      1 - 70
RITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEG     71 - 140
IFSRVVQYH                                                                 141 - 149
//

Text Mined References (18)

PMID Year Title