Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.06
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.99743753380818E-8
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0320643082537583

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.377 0.032
ovarian cancer -1.500 0.000

Synonym

Accession Q9BYC8 Q96Q68 Q9P098 L32mt
Symbols L32mt
HSPC283
MRP-L32
bMRP-59b

Gene

PDB

3J9M   3J7Y  

  Ortholog (12)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALAMLVLVVSPWSAARGVLRNYWERLLRKLPQSRPGFPSPPWGPALAVQGPAMFTEPANDTSGSKENSS      1 - 70
LLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYEKVCKETAEIRRQ     71 - 140
IGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERDRKRPSWFTQN                          141 - 188
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
More...