Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.93
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.500 2.0e-08
pancreatic ductal adenocarcinoma liver m... -1.377 3.2e-02

Gene RIF (1)

AA Sequence

MALAMLVLVVSPWSAARGVLRNYWERLLRKLPQSRPGFPSPPWGPALAVQGPAMFTEPANDTSGSKENSS      1 - 70
LLDSIFWMAAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYEKVCKETAEIRRQ     71 - 140
IGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERDRKRPSWFTQN                          141 - 188
//

Text Mined References (18)

PMID Year Title