Property Summary

NCBI Gene PubMed Count 52
PubMed Score 92.91
PubTator Score 70.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.305 3.2e-02
active ulcerative colitis 1.250 5.8e-03
Barrett's esophagus 1.100 2.1e-02
cystic fibrosis 1.779 1.2e-06
esophageal adenocarcinoma 1.600 1.9e-02
group 4 medulloblastoma -1.200 5.9e-04
intraductal papillary-mucinous adenoma (... 2.100 9.3e-05
intraductal papillary-mucinous carcinoma... 1.200 2.4e-02
invasive ductal carcinoma 1.100 1.8e-03
lung adenocarcinoma 1.100 2.8e-06
lung cancer -2.400 5.1e-04
malignant mesothelioma -2.000 5.4e-08
medulloblastoma, large-cell -1.800 4.9e-05
non-small cell lung carcinoma 1.100 6.6e-29
osteosarcoma 2.563 8.0e-07
ovarian cancer 1.100 5.3e-03
periodontitis 1.100 2.4e-22
subependymal giant cell astrocytoma -1.787 4.6e-03
tuberculosis 1.300 5.5e-06

Protein-protein Interaction (6)

Gene RIF (30)

AA Sequence

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP      1 - 70
EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL     71 - 140
EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL    141 - 210
VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE    211 - 280
VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT    281 - 350
KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK    351 - 420
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF    421 - 490
HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE    491 - 560
KIETVKYPTYPEAEK                                                           561 - 575
//

Text Mined References (56)

PMID Year Title