Property Summary

NCBI Gene PubMed Count 46
Grant Count 7
Funding $253,267.25
PubMed Score 78.18
PubTator Score 70.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
25572677 High expression of FUT8 is associated with an unfavorable clinical outcome in patients with potentially curatively resected NSCLCs, suggesting that FUT8 can be a prognostic factor.
25174450 MiR-198 was shown to target the 3'UTR of FUT8 directly to downregulate FUT8 expression.
24906821 Our results suggest that FUT8 may be associated with aggressive PCa and thus is potentially useful for its prognosis.
24232099 Results suggest that FUT4-, FUT6- or FUT8-mediated MDR in human HCC is associated with the activation of the PI3K/Akt pathway and the expression of MRP1.
24130780 miR-122 and miR-34a are able to target FUT8 3'UTR
23609441 findings define FUT8 as a novel factor for hemoglobin production and demonstrate that core fucosylation plays an important role in erythroid differentiation
23352314 alpha 1,6-fucosyltransferase 8 expression might be a good indicator of poor prognosis in hepatocellular carcinoma. High alpha 1,6-fucosyltransferase 8 expression may play an important role in hepatitis B virus-related hepatocellular carcinoma progression
22190034 HIV-1 gp160 is identified to have a physical interaction with fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22011814 The FUT8 gene Thr267Lys polymorphism is associated with human pulmonary emphysema (PE).
21652057 in colorectal carcinoma patients with moderate or strong alpha(1,6)fucosyltransferase expression, a significant decrease in the overall (P = .04) and disease-free (P = .03) survival rates was observed
More...

AA Sequence

MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP      1 - 70
EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL     71 - 140
EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL    141 - 210
VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE    211 - 280
VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT    281 - 350
KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK    351 - 420
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF    421 - 490
HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE    491 - 560
KIETVKYPTYPEAEK                                                           561 - 575
//

Text Mined References (50)

PMID Year Title
25572677 2015 Expression of fucosyltransferase 8 is associated with an unfavorable clinical outcome in non-small cell lung cancers.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25174450 2014 MiR-198 represses tumor growth and metastasis in colorectal cancer by targeting fucosyl transferase 8.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
24906821 2014 Overexpression of ? (1,6) fucosyltransferase associated with aggressive prostate cancer.
24232099 2013 FUT family mediates the multidrug resistance of human hepatocellular carcinoma via the PI3K/Akt signaling pathway.
24130780 2013 Effects of microRNAs on fucosyltransferase 8 (FUT8) expression in hepatocarcinoma cells.
23609441 2013 ?-1,6-Fucosyltransferase (FUT8) inhibits hemoglobin production during differentiation of murine and K562 human erythroleukemia cells.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23352314 2013 Expression of alpha 1,6-fucosyltransferase 8 in hepatitis B virus-related hepatocellular carcinoma influences tumour progression.
More...