Property Summary

NCBI Gene PubMed Count 91
PubMed Score 182.88
PubTator Score 138.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.600 9.3e-07
astrocytoma -1.500 4.1e-16
Astrocytoma, Pilocytic -1.800 1.9e-07
atypical teratoid / rhabdoid tumor -2.900 3.4e-12
breast carcinoma -1.700 2.0e-04
ductal carcinoma in situ -1.200 5.5e-04
ependymoma -2.700 5.9e-21
fibroadenoma -1.400 4.9e-02
glioblastoma -2.500 2.8e-10
group 3 medulloblastoma -2.900 2.1e-05
interstitial cystitis 1.500 8.6e-06
intraductal papillary-mucinous adenoma (... -1.100 1.1e-03
intraductal papillary-mucinous carcinoma... -1.200 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 4.3e-03
invasive ductal carcinoma -1.900 5.4e-04
lung adenocarcinoma -1.600 2.6e-08
medulloblastoma, large-cell -3.500 4.7e-07
non-small cell lung cancer -1.714 6.6e-19
oligodendroglioma -1.400 3.6e-13
primitive neuroectodermal tumor -1.800 7.7e-05
subependymal giant cell astrocytoma -3.470 1.6e-02

Protein-protein Interaction (1)

Gene RIF (51)

AA Sequence

MDGPGASAVVVRVGIPDLQQTKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQPPSRGRAGKFLDE      1 - 70
ERLLQEYPPNLDTPLPYLEFRYKRRVYAQNLIDDKQFAKLHTKANLKKFMDYVQLHSTDKVARLLDKGLD     71 - 140
PNFHDPDSGECPLSLAAQLDNATDLLKVLKNGGAHLDFRTRDGLTAVHCATRQRNAAALTTLLDLGASPD    141 - 210
YKDSRGLTPLYHSALGGGDALCCELLLHDHAQLGITDENGWQEIHQACRFGHVQHLEHLLFYGADMGAQN    211 - 280
ASGNTALHICALYNQESCARVLLFRGANRDVRNYNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETP    281 - 350
SYAKRRRLAGPSGLASPRPLQRSASDINLKGEAQPAASPGPSLRSLPHQLLLQRLQEEKDRDRDADQESN    351 - 420
ISGPLAGRAGQSKISPSGPGGPGPAPGPGPAPPAPPAPPPRGPKRKLYSAVPGRKFIAVKAHSPQGEGEI    421 - 490
PLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQHDTRPETREDRTKRLFRHYTVGSYDSLT    491 - 560
SHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFL    561 - 630
IEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAEL    631 - 700
EELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLP    701 - 770
GSLRKGIPRTKSVGEDEKLASLLEGRFPRSTSMQDPVREGRGIPPPPQTAPPPPPAPYYFDSGPPPAFSP    771 - 840
PPPPGRAYDTVRSSFKPGLEARLGAGAAGLYEPGAALGPLPYPERQKRARSMIILQDSAPESGDAPRPPP    841 - 910
AATPPERPKRRPRPPGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSPGPGGGS    911 - 980
FAREPSPTHRGPRPGGLDYGAGDGPGLAFGGPGPAKDRRLEERRRSTVFLSVGAIEGSAPGADLPSLQPS    981 - 1050
RSIDERLLGTGPTAGRDLLLPSPVSALKPLVSGPSLGPSGSTFIHPLTGKPLDPSSPLALALAARERALA   1051 - 1120
SQAPSRSPTPVHSPDADRPGPLFVDVQARDPERGSLASPAFSPRSPAWIPVPARREAEKVPREERKSPED   1121 - 1190
KKSMILSVLDTSLQRPAGLIVVHATSNGQEPSRLGGAEEERPGTPELAPAPMQSAAVAEPLPSPRAQPPG   1191 - 1260
GTPADAGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGVLLATPLAGPGPSP   1261 - 1330
TTVPSPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMSTLSSESGELTDTHTSFA   1331 - 1400
DGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHAASAGLASAAGPARPRYLFQRR   1401 - 1470
SKLWGDPVESRGLPGPEDDKPTVISELSSRLQQLNKDTRSLGEEPVGGLGSLLDPAKKSPIAAARLFSSL   1471 - 1540
GELSSISAQRSPGGPGGGASYSVRPSGRYPVARRAPSPVKPASLERVEGLGAGAGGAGRPFGLTPPTILK   1541 - 1610
SSSLSIPHEPKEVRFVVRSVSARSRSPSPSPLPSPASGPGPGAPGPRRPFQQKPLQLWSKFDVGDWLESI   1611 - 1680
HLGEHRDRFEDHEIEGAHLPALTKDDFVELGVTRVGHRMNIERALRQLDGS                      1681 - 1731
//

Text Mined References (96)

PMID Year Title