Property Summary

NCBI Gene PubMed Count 27
Grant Count 6
R01 Count 6
Funding $157,942.8
PubMed Score 21.45
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (16)

PMID Text
26988444 The crystal structure of JNK1 bound to the catalytic domain of MKP7 at 2.4-A resolution, providing high-resolution structural insight into the FXF-docking interaction, is reported.
26381291 The DUSP16 ablation leads to a G1/S transition arrest, reduced incorporation of 5-bromodeoxyuridine, enhanced senescence-associated beta-galactosidase activity, and formation of senescence-associated heterochromatic foci.
23926106 analysis of the interaction of the MAPK binding domain of DUSP16 with p38alpha
23639976 PPARdelta-mediated messenger RNA stabilization of mitogen-activated protein kinase phosphatase (MKP)-7 was responsible for the GW501516-mediated inhibition of JNK signaling.
23233447 Data indicate that the activities of phosphoprotein phosphatases MKP5 and MKP7 were determined in the system.
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
22245064 DUSPs 10 and 16 are positive regulators of activation, apparently acting by modulating cross-talk between the p38 and ERK pathways.
22182512 MKP-7, a negative regulator of JNK, regulates VCAM-1 expression in activated endothelial cells through IRF-1 but not GATA6.
20551953 DUSP16 is a new epigenetically regulated determinant of JNK activation in BL.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQ      1 - 70
HSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKS     71 - 140
TLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFLRVP    141 - 210
VNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPT    211 - 280
ISPNFNFLGQLLDYEKKIKNQTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAA    281 - 350
GQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF    351 - 420
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKLQTARPSDSQSKRLHSVRTS    421 - 490
SSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWHSDILAPQTSTPSLTSSWYFA    491 - 560
TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQM    561 - 630
EFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS                                       631 - 665
//

Text Mined References (29)

PMID Year Title
26988444 2016 A conserved motif in JNK/p38-specific MAPK phosphatases as a determinant for JNK1 recognition and inactivation.
26381291 2015 DUSP16 ablation arrests the cell cycle and induces cellular senescence.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
23926106 2013 Structural basis for the regulation of the mitogen-activated protein (MAP) kinase p38? by the dual specificity phosphatase 16 MAP kinase binding domain in solution.
23639976 2013 PPAR? inhibits UVB-induced secretion of MMP-1 through MKP-7-mediated suppression of JNK signaling.
23233447 2013 A high-throughput assay for phosphoprotein-specific phosphatase activity in cellular extracts.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
22245064 2012 Dual specificity phosphatases 10 and 16 are positive regulators of EGF-stimulated ERK activity: indirect regulation of ERK signals by JNK/p38 selective MAPK phosphatases.
22182512 2012 MKP-7, a negative regulator of JNK, regulates VCAM-1 expression through IRF-1.
More...