Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.44
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.1e-04
breast carcinoma 1.500 2.1e-03
inflammatory breast cancer -1.200 3.2e-03
interstitial cystitis -1.200 1.5e-05
osteosarcoma -1.278 6.3e-04
pancreatic ductal adenocarcinoma liver m... -1.259 4.0e-02
primitive neuroectodermal tumor 1.200 1.6e-03
sonic hedgehog group medulloblastoma 1.400 3.0e-05
spina bifida -2.202 4.1e-02
tuberculosis -2.900 7.7e-09
ulcerative colitis -1.300 1.6e-05
urothelial carcinoma -1.200 6.4e-04

Gene RIF (16)

AA Sequence

MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQ      1 - 70
HSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFNSVHLLAGGFAEFSRCFPGLCEGKS     71 - 140
TLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFLRVP    141 - 210
VNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPT    211 - 280
ISPNFNFLGQLLDYEKKIKNQTGASGPKSKLKLLHLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAA    281 - 350
GQRPVHPASVPSVPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF    351 - 420
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKLQTARPSDSQSKRLHSVRTS    421 - 490
SSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWHSDILAPQTSTPSLTSSWYFA    491 - 560
TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQM    561 - 630
EFGESIMSENRSREELGKVGSQSSFSGSMEIIEVS                                       631 - 665
//

Text Mined References (30)

PMID Year Title