Property Summary

NCBI Gene PubMed Count 20
Grant Count 13
R01 Count 13
Funding $972,605.22
PubMed Score 9.07
PubTator Score 12.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.100 0.008
ependymoma 1.600 0.009
oligodendroglioma 1.800 0.003
group 4 medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.100 0.006
subependymal giant cell astrocytoma -1.043 0.019
Gaucher disease type 1 -1.500 0.028

Gene RIF (7)

PMID Text
25378556 hnRNP-U inhibits TDP-43-mediated alterations in splicing of POLDIP3 mRNA.
25049393 these findings establish critical and essential roles for SKAR in the regulation of mRNA translation of IFN-sensitive genes and induction of IFN-alpha biological responses.
22928037 PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22900096 Alteration of POLDIP3 splicing associated with loss of function of TDP-43 in tissues affected with amyotrophic lateral sclerosis (ALS) .
18423201 SKAR-mediated recruitment of activated S6K1 to newly processed mRNPs serves as a conduit between mTOR checkpoint signaling and the pioneer round of translation when cells exist in conditions supportive of protein synthesis.
16984396 This study showed that PDIP46 aka SKAR, a protein possessing one RNA recognition motif (RRM) and being a protein partner of both the p50 subunit of DNA polymerase delta and p70 ribosomal protein S6 kinase 1 (S6K1).
15341740 SKAR is a specific target of S6K1 and regulates cell growth.

AA Sequence

MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG      1 - 70
VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT     71 - 140
PALKLTKTIQVPQQKAMAPLHPHPAGMRINVVNNHQAKQNLYDLDEDDDGIASVPTKQMKFAASGGFLHH    141 - 210
MAGLSSSKLSMSKALPLTKVVQNDAYTAPALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGT    211 - 280
KMTVNNLHPRVTEEDIVELFCVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHM    281 - 350
NGNVITSDQPILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIK    351 - 420
L//

Text Mined References (33)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25378556 2015 Nuclear TDP-43 causes neuronal toxicity by escaping from the inhibitory regulation by hnRNPs.
25049393 2014 Regulatory effects of SKAR in interferon ? signaling and its role in the generation of type I IFN responses.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928037 2012 The proteins PDIP3 and ZC11A associate with the human TREX complex in an ATP-dependent manner and function in mRNA export.
22900096 2012 Alteration of POLDIP3 splicing associated with loss of function of TDP-43 in tissues affected with ALS.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...