Property Summary

NCBI Gene PubMed Count 21
PubMed Score 11.46
PubTator Score 12.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.100 7.6e-03
ependymoma 1.600 9.1e-03
Gaucher disease type 1 -1.500 2.8e-02
group 4 medulloblastoma 1.400 4.3e-04
medulloblastoma, large-cell 1.100 6.1e-03
oligodendroglioma 1.100 2.8e-02
subependymal giant cell astrocytoma -1.043 1.9e-02

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (8)

AA Sequence

MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLG      1 - 70
VKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVT     71 - 140
PALKLTKTIQVPQQKAMAPLHPHPAGMRINVVNNHQAKQNLYDLDEDDDGIASVPTKQMKFAASGGFLHH    141 - 210
MAGLSSSKLSMSKALPLTKVVQNDAYTAPALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGT    211 - 280
KMTVNNLHPRVTEEDIVELFCVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHM    281 - 350
NGNVITSDQPILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIK    351 - 420
L//

Text Mined References (35)

PMID Year Title