Property Summary

NCBI Gene PubMed Count 168
PubMed Score 339.29
PubTator Score 205.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 4.4e-03
atypical teratoid / rhabdoid tumor -1.700 4.0e-04
Breast cancer -1.600 5.0e-12
breast carcinoma -2.400 1.0e-03
ductal carcinoma in situ -1.600 2.9e-03
fibroadenoma -2.900 2.6e-03
glioblastoma -1.100 1.2e-02
group 3 medulloblastoma -1.500 5.9e-03
intraductal papillary-mucinous adenoma (... -1.900 2.4e-04
intraductal papillary-mucinous carcinoma... -1.300 3.0e-03
invasive ductal carcinoma -1.800 1.3e-02
malignant mesothelioma -3.200 2.6e-07
medulloblastoma, large-cell -3.000 2.2e-07
pediatric high grade glioma -1.500 1.8e-03
posterior fossa group B ependymoma -1.400 5.9e-04
primitive neuroectodermal tumor -1.900 1.0e-03
psoriasis 2.200 3.1e-05
ulcerative colitis 1.100 1.9e-04

Protein-protein Interaction (8)

Gene RIF (131)

AA Sequence

MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALE      1 - 70
RRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHL     71 - 140
QSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSP    141 - 210
PFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDW    211 - 280
DGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWW    281 - 350
FGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS                  351 - 406
//

Text Mined References (170)

PMID Year Title