Property Summary

NCBI Gene PubMed Count 144
Grant Count 57
R01 Count 24
Funding $4,080,192.23
PubMed Score 297.98
PubTator Score 205.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BY76 A8MY84 B4E089 D6W670 F5H0I2 Q53HQ6 Q53HU1 Q6UXN0 Q9HBV4 Q9NZU4 Q9Y5B3
Symbols NL2
ARP4
FIAF
HARP
PGAR
HFARP
TGQTL
UNQ171
pp1158

Gene

PANTHER Protein Class (1)

 IMPC Term (1)

Gene RIF (108)

PMID Text
27053616 Knockdown of ANGPTL4 inhibits proliferation and promotes apoptosis in cervical cancer.
26934567 We found that carriers of loss-of-function mutations in ANGPTL4 had triglyceride levels that were lower than those among noncarriers; these mutations were also associated with protection from coronary artery disease.
26933753 Carriers of E40K and other inactivating mutations in ANGPTL4 had lower levels of triglycerides and a lower risk of coronary artery disease than did noncarriers.
26813452 circulating ANGPTL4 levels are up-regulated in COPD patients, and have correlations with pulmonary function and systematic inflammation in COPD
26745120 ANGPTL4 mRNA expressions and serum levels were significantly higher in high grade breast carcinoma.
26546816 Collectively, our findings indicate that miR-134 may regulate lipid accumulation and proinfiammatory cytokine secretion in macrophages by targeting the ANGPTL4 gene.
26417691 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7.
26363050 A1AT binds to FA, and it is this form of A1AT that induces Angptl4 and FABP4 expression via a PPAR-dependent pathway.
26291814 ANGPTL4 levels were higher in both obese and non-obese PCOS patients compared to healthy controls.
26039997 results suggest targeting both ANGPTL4 and VEGF may be necessary for effective treatment or prevention of PDR and provide the foundation for studies evaluating aqueous ANGPTL4 as a biomarker to help guide individualized therapy for diabetic eye disease
More...

AA Sequence

MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALE      1 - 70
RRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHL     71 - 140
QSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSP    141 - 210
PFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDW    211 - 280
DGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWW    281 - 350
FGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS                  351 - 406
//

Text Mined References (146)

PMID Year Title
27053616 2016 [Knockdown of angiopoietin-like protein 4 inhibits proliferation and promotes apoptosis in cervical cancer SiHa cells].
26934567 2016 Coding Variation in ANGPTL4, LPL, and SVEP1 and the Risk of Coronary Disease.
26933753 2016 Inactivating Variants in ANGPTL4 and Risk of Coronary Artery Disease.
26813452 2016 Serum angiopoietin-like 4 is over-expressed in COPD patients: association with pulmonary function and inflammation.
26745120 2015 Significance of Tissue Expression and Serum Levels of Angiopoietin-like Protein 4 in Breast Cancer Progression: Link to NF-?B /P65 Activity and Pro-Inflammatory Cytokines.
26546816 2016 MicroRNA-134 actives lipoprotein lipase-mediated lipid accumulation and inflammatory response by targeting angiopoietin-like 4 in THP-1 macrophages.
26417691 2015 Angiopoietin-like 4 enhances metastasis and inhibits apoptosis via inducing bone morphogenetic protein 7 in colorectal cancer cells.
26363050 2015 ?1-Antitrypsin Combines with Plasma Fatty Acids and Induces Angiopoietin-like Protein 4 Expression.
26291814 2015 Examination of angiopoietin-like protein 4, neuropeptide Y, omentin-1 levels of obese and non-obese patients with polycystic ovary syndrome.
26039997 2015 Angiopoietin-like 4 is a potent angiogenic factor and a novel therapeutic target for patients with proliferative diabetic retinopathy.
More...