Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.75
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Hemorrhagic fever with renal syndrome 7 3.176 1.6

Expression

Synonym

Accession Q9BY71 Q0VDJ2
Symbols LRRC3DN
C21orf30
C21orf102

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGTVRPPRPSLLLVSTRESCLFLLFCLHLGAACPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLK      1 - 70
LDANKISHLPDGAFQHLHRLRELDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKI     71 - 140
RLSHNPLHCECALQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAMLVT    141 - 210
MFGWFAMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPASKDPIGPGP                           211 - 257
//

Text Mined References (9)

PMID Year Title