Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.83
PubTator Score 8.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession Q9BY64 B5BUM0 Q9BY62 Q9BY63 UDPGT 2B28
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
21679149 UGT2B28 was clearly detected in breast and adipose tissue; GT2B28 expression in the breast was comparatively low, about 1.6% of GAPDH mRNA levels, and was less than 5% of normalized (against GAPDH) UGT2B7 and 2B10 mRNA expression levels in the liver
20056642 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19572376 Copy-number variations (CNVs) of the human sex steroid metabolizing genes UGT2B28

AA Sequence

MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAF      1 - 70
TLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKL     71 - 140
QESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTIERHSGGLIFPPSYIPVVMSKLSDQMTFMER    141 - 210
VKNMIYVLYFDFWFQMCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGL    211 - 280
HCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLN    281 - 350
TRLYKWIPQNDLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM    351 - 420
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHS    421 - 490
LDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD                                   491 - 529
//

Text Mined References (6)

PMID Year Title
21679149 2011 Quantitative analysis of UGT2B28 mRNA expression by real-time RT-PCR and application to human tissue distribution study.
20056642 2010 Genetic variation of genes involved in dihydrotestosterone metabolism and the risk of prostate cancer.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19572376 2009 Copy-number variations (CNVs) of the human sex steroid metabolizing genes UGT2B17 and UGT2B28 and their associations with a UGT2B15 functional polymorphism.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
11300766 2001 Isolation and characterization of the UGT2B28 cDNA encoding a novel human steroid conjugating UDP-glucuronosyltransferase.