Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MKFQYKEVHPFEYRKKEGEKIRKKYPDRVPLIVEKAPKARVPDLDRRKYLVPSDLTDGQFYLLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDSHEEDDFLYVAYSNESVYGK                            71 - 117
//

Text Mined References (2)

PMID Year Title
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
11414770 2001 Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein.