Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.12
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.0e-07
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.7

AA Sequence

MKFQYKEVHPFEYRKKEGEKIRKKYPDRVPLIVEKAPKARVPDLDRRKYLVPSDLTDGQFYLLIRKRIHL      1 - 70
RPEDALFFFVNNTIPPTSATMGQLYEDSHEEDDFLYVAYSNESVYGK                            71 - 117
//

Text Mined References (2)

PMID Year Title