Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.63
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.234 3.5e-03
acute myeloid leukemia -1.300 3.3e-03
ependymoma -1.200 1.8e-09
group 3 medulloblastoma -1.500 6.7e-05
interstitial cystitis 1.600 3.3e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.4e-03
lung carcinoma 3.700 3.1e-39
osteosarcoma -1.391 8.7e-03
ovarian cancer -1.200 4.7e-04
pancreatic ductal adenocarcinoma liver m... -1.987 1.2e-03
ulcerative colitis 1.100 2.1e-04

 GO Process (1)

Protein-protein Interaction (8)

AA Sequence

MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME      1 - 70
PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE     71 - 140
GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES                      141 - 192
//

Text Mined References (8)

PMID Year Title