Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.55
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9BY50 B2RAA3
Symbols SPC21
SPCS4C
SEC11L3

Gene

 GO Process (1)

AA Sequence

MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME      1 - 70
PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE     71 - 140
GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES                      141 - 192
//

Text Mined References (8)

PMID Year Title
23995782 2014 Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-? secretion in gastric cancer.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9631292 1998 The role of assembly in insulin's biosynthesis.
2188978 1990 Two subunits of the canine signal peptidase complex are homologous to yeast SEC11 protein.