Property Summary

NCBI Gene PubMed Count 15
PubMed Score 43.24
PubTator Score 14.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.300 5.7e-03
ductal carcinoma in situ -1.700 8.6e-04
invasive ductal carcinoma -1.400 1.4e-02
malignant mesothelioma -3.300 1.1e-08
ovarian cancer 1.100 5.5e-09
pancreatic ductal adenocarcinoma liver m... -1.271 1.3e-03
psoriasis -1.300 6.6e-04
tuberculosis 1.200 2.3e-05
ulcerative colitis -1.100 3.9e-04

Protein-protein Interaction (4)

Gene RIF (3)

AA Sequence

MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTK      1 - 70
QARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCK     71 - 140
AVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAV    141 - 210
ENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNW    211 - 280
PKGAGDLSVVKKMKETFKEKAKL                                                   281 - 303
//

Text Mined References (17)

PMID Year Title