Property Summary

NCBI Gene PubMed Count 26
PubMed Score 4.12
PubTator Score 366.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Disease Target Count P-value
acute quadriplegic myopathy 1158 1.8e-06
ovarian cancer 8520 2.4e-04
sonic hedgehog group medulloblastoma 467 2.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.006 1.8e-06
ovarian cancer -1.300 2.4e-04
sonic hedgehog group medulloblastoma 1.400 2.7e-04

Gene RIF (19)

AA Sequence

MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLL      1 - 70
HSFDLLKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCLKSFIQKKMQNWCPSWSEDET     71 - 140
LCARNVNNEVHFFENNNFNTIANKLHLQKINDFVLSPGPQPYKVAVYVPGSKGAPSFVRLYQYPNFAGPH    141 - 210
AALANKSFFKADKVTMLWNKKATAVLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVV    211 - 280
WNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYK    281 - 350
LISKPVASDSTYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQVSWQPFLDGI    351 - 420
FPAKTITYQAVPSEVPNEEPKVATAYRPPALRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRK    421 - 490
HEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQLKEQAATGKQL    491 - 560
EKNQLEKIQKETALLQELEDLELGI                                                 561 - 585
//

Text Mined References (38)

PMID Year Title