Property Summary

NCBI Gene PubMed Count 21
Grant Count 117
R01 Count 90
Funding $14,733,184.72
PubMed Score 3.87
PubTator Score 366.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.006 0.000
sonic hedgehog group medulloblastoma 1.400 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q9BY44 A8MPS6 B4DF96 B4DQ14 D3DNI9 Q5QTR2 Q7Z4E9 Q8NFM1 Q96EW9 Q96K81 eIF-2A
Symbols CDA02
EIF-2A
MST089
MSTP004
MSTP089

Gene

Gene RIF (13)

PMID Text
26869028 The Newcastle disease virus-induced translation shutoff at late infection times was attributed to sustaining phosphorylation of eIF2a, which is mediated by continual activation of PKR and degradation of PP1.
26743901 The results suggest that dephosphorylation of eIF2a by GADD34 plays an important role in doxorubicin resistance of MCF-7/ADR cells.
26542945 We identified EIF2A phosphorylation as a novel early molecular event occurring in response to NAMPT inhibition and mediating protein synthesis arrest.
26406898 These experiments connect embryonic stem cell growth factors to eIF2alpha phosphorylation.
26095357 The data highlight independent interactions of PP1 and eIF2alpha with GADD34, demonstrating that GADD34 functions as a scaffold both in vitro and in cells
25749194 analysis of the ER stress response in immunogenic cell death and the potential value of eIF2alpha phosphorylation as a biomarker for this clinically relevant variant of apoptosis [review]
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20376341 hypusine-eIF5A-facilitated translation elongation promotes arsenite-induced polysome disassembly and stress granule assembly in cells subjected to adverse environmental conditions
19913121 Observational study of gene-disease association. (HuGE Navigator)
17894550 ABC50 N-terminal region interacts with eukaryotic initiation factor eIF2 and is a target for regulatory phosphorylation by CK2
More...

AA Sequence

MAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLL      1 - 70
HSFDLLKAVCLEFSPKNTVLATWQPYTTSKDGTAGIPNLQLYDVKTGTCLKSFIQKKMQNWCPSWSEDET     71 - 140
LCARNVNNEVHFFENNNFNTIANKLHLQKINDFVLSPGPQPYKVAVYVPGSKGAPSFVRLYQYPNFAGPH    141 - 210
AALANKSFFKADKVTMLWNKKATAVLVIASTDVDKTGASYYGEQTLHYIATNGESAVVQLPKNGPIYDVV    211 - 280
WNSSSTEFCAVYGFMPAKATIFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYK    281 - 350
LISKPVASDSTYFAWCPDGEHILTATCAPRLRVNNGYKIWHYTGSILHKYDVPSNAELWQVSWQPFLDGI    351 - 420
FPAKTITYQAVPSEVPNEEPKVATAYRPPALRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRK    421 - 490
HEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQLKEQAATGKQL    491 - 560
EKNQLEKIQKETALLQELEDLELGI                                                 561 - 585
//

Text Mined References (33)

PMID Year Title
26869028 2016 Regulation of de novo translation of host cells by manipulation of PERK/PKR and GADD34-PP1 activity during Newcastle disease virus infection.
26743901 2016 Salubrinal-Mediated Upregulation of eIF2? Phosphorylation Increases Doxorubicin Sensitivity in MCF-7/ADR Cells.
26542945 2015 EIF2A-dependent translational arrest protects leukemia cells from the energetic stress induced by NAMPT inhibition.
26406898 2015 Embryonic Stem Cell Growth Factors Regulate eIF2? Phosphorylation.
26095357 2015 Structural and Functional Analysis of the GADD34:PP1 eIF2? Phosphatase.
25749194 2015 eIF2? phosphorylation as a biomarker of immunogenic cell death.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...