Property Summary

NCBI Gene PubMed Count 29
Grant Count 35
R01 Count 18
Funding $4,051,429.84
PubMed Score 14.79
PubTator Score 21.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
24107264 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
23527201 Chmp4, through Alix, recruits the human parainfluenza virus type 1 - C proteins to a common site on intracellular membranes and facilitates budding.
22762019 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
22754649 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
22258254 CC2D1A interaction with CHMP4B/4A blocks HIV-1 budding.
21975012 hSnf7-1 and hSnf7-2 are preferentially associated with CHMP2A and CHMP2B, respectively, and regulate the turnover of distinct transmembrane cargos such as neurotransmitter receptors in human neurons.
21789505 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
21789505 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
21762798 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
21762796 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
More...

AA Sequence

MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKK      1 - 70
RFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQ     71 - 140
QISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDED    141 - 210
EEALKQLAEWVS                                                              211 - 222
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
23527201 2013 Alix serves as an adaptor that allows human parainfluenza virus type 1 to interact with the host cell ESCRT system.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22258254 2012 Regulation of CHMP4/ESCRT-III function in human immunodeficiency virus type 1 budding by CC2D1A.
21975012 2011 ESCRT-III subunits Snf7-1 and Snf7-2 differentially regulate transmembrane cargos in hESC-derived human neurons.
More...