Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 2.900 6.1e-03
adult high grade glioma -1.300 1.0e-03
atypical teratoid/rhabdoid tumor -1.100 5.1e-04
osteosarcoma -1.086 3.6e-05
ovarian cancer 1.100 1.0e-03

Synonym

Accession Q9BY42 E1P5Z9 Q9BYL7 Q9HCV9 Q9NX29 Q9NZZ8 Q9P002 Q9UHW3
Symbols CDAO5
RTFDC1
HSPC164
C20orf43
SHUJUN-3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKDAVIEFLLDKS      1 - 70
AEKALGKAASHIKSIKNVTELKLSDNPAWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCC     71 - 140
GCVFSERALKEIKAEVCHTCGAAFQEDDVIMLNGTKEDVDVLKTRMEERRLRAKLEKKTKKPKAAESVSK    141 - 210
PDVSEEAPGPSKVKTGKPEEASLDSREKKTNLAPKSTAMNESSSGKAGKPPCGATKRSIADSEESEAYKS    211 - 280
LFTTHSSAKRSKEESAHWVTHTSYCF                                                281 - 306
//

Text Mined References (13)

PMID Year Title