Property Summary

NCBI Gene PubMed Count 66
Grant Count 108
R01 Count 85
Funding $12,203,080.55
PubMed Score 229.38
PubTator Score 152.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q9BY41 A6ND12 A6ND61 A6NET3 A6NJR3 A8MQ62 B4DKN0 B4DV22 Q86VC8 Q9NP76 Q9NYH4 HD8
Symbols HD8
WTS
RPD3
CDA07
CDLS5
MRXS6
HDACL1

Gene

PANTHER Protein Class (2)

PDB

1T64   1T67   1T69   1VKG   1W22   2V5W   2V5X   3EW8   3EWF   3EZP   3EZT   3F06   3F07   3F0R   3MZ3   3MZ4   3MZ6   3MZ7   3RQD   3SFF   3SFH   4QA0   4QA1   4QA2   4QA3   4QA4   4QA5   4QA6   4QA7   4RN0   4RN1   4RN2   5BWZ   5D1B   5D1C   5D1D   5DC5   5DC6   5DC7   5DC8  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651908 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC8

Gene RIF (51)

PMID Text
26923266 Studies indicate that histone deacetylase 8 protein (HDAC8) aberrantly deacetylates p53 protein and promotes leukemia stem cells (LSCs) transformation and maintenance.
26806311 The H143A and H142A/H143A mutants exhibit activity that is >80000-fold lower than that of wild-type HDAC8; the buried D176N and D176A mutants have significant catalytic effects, with more subtle effects caused by D183N and D183A
26792731 cAMP signaling increases HDAC8 protein levels by reducing JNK-mediated autophagy and ubiquitin-proteasome-dependent degradation of the HDAC8 protein in H1299 lung cancer cells.
26463496 Report the preparation and biophysical evaluation of five HDAC8 mutants: P91L, G117E, H180R, D233G, and G304R. Additionally, the double mutants D233G-Y306F and P91L-Y306F were prepared to enable cocrystallization of intact enzyme-substrate complexes.
26412386 Our data exhibited an important role of HDAC8 in promoting gastric cancer tumorigenesis and identify this HDAC8 as a potential therapeutic target for the treatment of gastric cancer.
26402585 Results provide direct evidence that potential KDAC8 substrates can be directly deacetylated by KDAC8.
26387755 study elucidates an HDAC8-mediated p53-inactivating mechanism promoting leukemia stem cells activity
26383163 findings show how HDAC8 drives nonalcoholic fatty liver disease-associated hepatocarcinogenesis
26200462 HDAC8i induced cell growth inhibition and marked S-phase cell cycle arrest in human and murine-derived MPNST cells
25836739 HDAC8 was increased in BRAF-mutated melanoma. Increased cytoplasmic HDAC8 immunoreactivity was independently associated with an improved survival from both diagnosis of primary melanoma and from first detection of stage IV disease to melanoma death
More...

AA Sequence

MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATF      1 - 70
HTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGG     71 - 140
WHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPG    141 - 210
TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMT    211 - 280
PVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP    281 - 350
SCRPDRNEPHRIQQILNYIKGNLKHVV                                               351 - 377
//

Text Mined References (69)

PMID Year Title
26923266 2016 Regain control of p53: Targeting leukemia stem cells by isoform-specific HDAC inhibition.
26806311 2016 General Base-General Acid Catalysis in Human Histone Deacetylase 8.
26792731 2016 cAMP signaling increases histone deacetylase 8 expression by inhibiting JNK-dependent degradation via autophagy and the proteasome system in H1299 lung cancer cells.
26463496 2015 Biochemical and structural characterization of HDAC8 mutants associated with Cornelia de Lange syndrome spectrum disorders.
26412386 2015 The inhibition of histone deacetylase 8 suppresses proliferation and inhibits apoptosis in gastric adenocarcinoma.
26402585 2015 KDAC8 substrate specificity quantified by a biologically relevant, label-free deacetylation assay.
26387755 2015 HDAC8 Inhibition Specifically Targets Inv(16) Acute Myeloid Leukemic Stem Cells by Restoring p53 Acetylation.
26383163 2015 Histone Deacetylase HDAC8 Promotes Insulin Resistance and ?-Catenin Activation in NAFLD-Associated Hepatocellular Carcinoma.
26200462 2015 HDAC8, A Potential Therapeutic Target for the Treatment of Malignant Peripheral Nerve Sheath Tumors (MPNST).
25836739 2015 Expression of the class 1 histone deacetylases HDAC8 and 3 are associated with improved survival of patients with metastatic melanoma.
More...