Property Summary

Ligand Count 606
NCBI Gene PubMed Count 80
PubMed Score 263.47
PubTator Score 152.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (66)

AA Sequence

MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATF      1 - 70
HTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATITAAQCLIDGMCKVAINWSGG     71 - 140
WHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPG    141 - 210
TGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMT    211 - 280
PVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP    281 - 350
SCRPDRNEPHRIQQILNYIKGNLKHVV                                               351 - 377
//

Text Mined References (83)

PMID Year Title