Property Summary

NCBI Gene PubMed Count 100
Grant Count 113
R01 Count 71
Funding $13,064,869.68
PubMed Score 331.95
PubTator Score 169.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.000
glioblastoma 1.200 0.001
lung cancer 1.600 0.001

Synonym

Accession Q9BY32 A2A2N2 A4UIM5 B2BCH7 O14878 Q5JWH4 Q9BYN1 Q9BYX0 Q9H3H8 ITPase
Symbols My049
ITPase
NTPase
C20orf37
dJ794I6.3
HLC14-06-P

Gene

PDB

2CAR   2I5D   2J4E   4F95  

Gene RIF (96)

PMID Text
26670100 The association of IL28B and APOH single nucleotide polymorphisms (SNPs) with sustained virological response and of ITPA SNPs with anemia related phenotypes.
26438033 polymorphisms increase the likelihood of developing hemolytic anemia for HCV-infected patients on RBV-based therapy, particularly rs1127354 CC and rs7270101 AA genotypes [meta-analysis]
26279293 The identification of ITPA protective and SLC29A1 risk genotypes still appears to be a current methodology in Ribavirin dosing during hepatitis C virus therapy with direct acting antiviral agents
26242828 results showed that patients with aberrant ITPase genotype (mutant homozygous or heterozygous), more likely to be myelosuppressed and show liver toxicity after treatment with 6-Mercaptopurine
26224535 Recessive ITPA mutations were associated with early infantile encephalopathy.
26223482 Hyperbilirubinemia develops at early time points after simeprevir administration in most cases and is dependent on the ITPA genotype.
26154744 ITPA SNPs in Brazilian patients receiving antiviral therapy for chronic hepatitis had a great propensity for developing ribavirin-induced anaemia.
26104535 Genetic variants in inosine triphosphatase (ITPA) gene have been linked to the haemolytic anaemia induced by peg-interferon and ribavirin treatment.
26030972 The significant association was found between the rs1127354 ITPA gene polymorphism and protection against ribavirin-induced hemolytic anemia in the Ukrainian patients with chronic hepatitis C infection.
25743001 Partial splenic embolism, in conjunction with triple combination therapy, is a useful and safe method to treat genotype 1b chronic hepatitis C patients with hypersplenism-induced thrombocytopenia
More...

AA Sequence

MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLV      1 - 70
EDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRI     71 - 140
VAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA                    141 - 194
//

Text Mined References (102)

PMID Year Title
26670100 2015 Impact of IL28B, APOH and ITPA Polymorphisms on Efficacy and Safety of TVR- or BOC-Based Triple Therapy in Treatment-Experienced HCV-1 Patients with Compensated Cirrhosis from the ANRS CO20-CUPIC Study.
26438033 2015 Relationship between ITPA polymorphisms and hemolytic anemia in HCV-infected patients after ribavirin-based therapy: a meta-analysis.
26279293 2015 ITPA and SLC29A1 Genotyping for the Prediction of Ribavirin Dose Reduction in Anti-HCV Triple Therapy with Protease Inhibitors.
26242828 2015 Frequency of ITPA gene polymorphisms in Iranian patients with acute lymphoblastic leukemia and prediction of its myelosuppressive effects.
26224535 2015 Recessive ITPA mutations cause an early infantile encephalopathy.
26223482 2016 The impact of an inosine triphosphate pyrophosphatase genotype on bilirubin increase in chronic hepatitis C patients treated with simeprevir, pegylated interferon plus ribavirin.
26154744 2015 Inosine triphosphatase allele frequency and association with ribavirin-induced anaemia in Brazilian patients receiving antiviral therapy for chronic hepatitis C.
26104535 2016 Protease inhibitors-based therapy induces acquired spherocytic-like anaemia and ineffective erythropoiesis in chronic hepatitis C virus patients.
26030972 ITPA gene variant may protect against anemia induced during pegylated interferon alfa and ribavirin combination treatment in Ukrainian patients with chronic hepatitis C.
25743001 2015 Safety and efficacy of partial splenic embolization in telaprevir-based triple therapy for chronic hepatitis C.
More...