Property Summary

NCBI Gene PubMed Count 109
PubMed Score 339.77
PubTator Score 169.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.200 8.0e-04
lung cancer 1.600 6.1e-04
psoriasis 1.400 1.8e-04

Gene RIF (104)

AA Sequence

MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLV      1 - 70
EDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRI     71 - 140
VAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA                    141 - 194
//

Text Mined References (111)

PMID Year Title