Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32
PubTator Score 8.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
DiGeorge syndrome 47 3.091 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 2.5e-03

AA Sequence

MLETYNSLVSLQELVSFEEVAVHFTWEEWQDLDDAQRTLYRDVMLETYSSLVSLGHCITKPEMIFKLEQG      1 - 70
AEPWIVEETPNLRLSAVQIIDDLIERSHESHDRFFWQIVITNSNTSTQERVELGKTFNLNSNHVLNLIIN     71 - 140
NGNSSGMKPGQFNDCQNMLFPIKPGETQSGEKPHVCDITRRSHRHHEHLTQHHKIQTLLQTFQCNEQGKT    141 - 210
FNTEAMFFIHKRVHIVQTFGKYNEYEKACNNSAVIVQVITQVGQPTCCRKSDFTKHQQTHTGEKPYECVE    211 - 280
CEKPSISKSDLMLQCKMPTEEKPYACNWCEKLFSYKSSLIIHQRIHTGEKPYGCNECGKTFRRKSFLTLH    281 - 350
ERTHTGDKPYKCIECGKTFHCKSLLTLHHRTHSGEKPYQCSECGKTFSQKSYLTIHHRTHTGEKPYACDH    351 - 420
CEEAFSHKSRLTVHQRTHTGEKPYECNECGKPFINKSNLRLHQRTHTGEKPYECNECGKTFHRKSFLTIH    421 - 490
QWTHTGEKPYECNECGKTFRCKSFLTVHQRTHAGEKPYACNECGKTYSHKSYLTVHHRTHTGEKPYECNE    491 - 560
CGKSFHCKSFLTIHQRTHAGKKPYECNECEKTFINKLNLGIHKITHTGERPYECNECGKTFRQKSNLSTH    561 - 630
QGTHTGEKPYVCGKTFHRKSFLTIHQRTHTGKNRMDVMNVEKLFVRNHTLLYIRELTPGKSPMNVMNVEN    631 - 700
PFIRRQIFRSIKVFTRGRNPMNVANVEKPCQKSVLTVHHRTHTGEKPYECNECGKTFCHKSNLSTHQGTH    701 - 770
SGEKPYECDECRKTFYDKTVLTIHQRTHTGEKPFECKECRKTFSQKSKLFVHHRTHTGEKPFRCNECRKT    771 - 840
FSQKSGLSIHQRTHTGEKPYECKECGKTFCQKSHLSRHQQTHIGEKSDVAEAGYVFPQNHSFFP          841 - 904
//

Text Mined References (5)

PMID Year Title