Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.64
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
22832905 Further studies are now needed to test the usefulness of DGCR6 and DGCR6L expression and alterations in the epigenome at these loci in predicting childhood anxiety and associated adult-onset pathologies in 22q11DS subjects.
19778628 DGCR6L, a novel PAK4 interacting protein, regulated PAK4-mediated migration of human gastric cancer cells via LIMK1.

AA Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI      1 - 70
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK     71 - 140
IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ    141 - 210
CDQKGSPVPP                                                                211 - 220
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
22832905 2012 Dysregulation of DGCR6 and DGCR6L: psychopathological outcomes in chromosome 22q11.2 deletion syndrome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
19778628 2010 DGCR6L, a novel PAK4 interaction protein, regulates PAK4-mediated migration of human gastric cancer cell via LIMK1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15821931 2005 Biochemical characterisation of the proteins encoded by the DiGeorge critical region 6 (DGCR6) genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...