Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.81
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BY27 A8K1N7 B3KMC0 D3DX29 Q9BW33
Symbols DGCR6

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI      1 - 70
QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK     71 - 140
IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ    141 - 210
CDQKGSPVPP                                                                211 - 220
//

Text Mined References (12)

PMID Year Title