Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.43
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.47834853220343E-12
nasopharyngeal carcinoma 1056 9.98149321820475E-8
lung adenocarcinoma 2714 2.77027701140937E-6
pituitary cancer 1972 8.90972441562676E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 9.40173902056526E-4
osteosarcoma 7933 0.00342471264109401
Endometriosis 535 0.00792155380128281
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00920894779689842
chronic rhinosinusitis 512 0.0151411662883411
ulcerative colitis 2087 0.0185809278053462
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0193547896522613

Expression

Gene RIF (1)

PMID Text
23348583 MS4A8B is a novel differentiation marker of the intestinal epithelium that supports the maintenance of a physiological barrier function in the gut by modulating the transcriptome and by conferring an increased resistance to reactive oxygen species.

AA Sequence

MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK      1 - 70
TLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLG     71 - 140
LNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV    141 - 210
CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK                                  211 - 250
//

Text Mined References (7)

PMID Year Title
23348583 2013 Identification of the novel differentiation marker MS4A8B and its murine homolog MS4A8A in colonic epithelial cells lost during neoplastic transformation in human colon.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11486273 2001 Structural organization of the human MS4A gene cluster on Chromosome 11q12.
11401424 2001 Identification of a CD20-, FcepsilonRIbeta-, and HTm4-related gene family: sixteen new MS4A family members expressed in human and mouse.
11245982 2001 Identification of a new multigene four-transmembrane family (MS4A) related to CD20, HTm4 and beta subunit of the high-affinity IgE receptor.