Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.43
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
chronic rhinosinusitis -1.954 1.5e-02
Endometriosis -1.956 7.9e-03
intraductal papillary-mucinous adenoma (... 1.500 9.4e-04
intraductal papillary-mucinous carcinoma... 2.000 1.9e-02
intraductal papillary-mucinous neoplasm ... 1.900 9.2e-03
lung adenocarcinoma -1.600 2.8e-06
lung carcinoma 4.100 4.5e-12
nasopharyngeal carcinoma -2.200 1.0e-07
osteosarcoma 1.365 3.4e-03
pituitary cancer 1.400 8.9e-04
ulcerative colitis -1.200 1.9e-02

Gene RIF (1)

AA Sequence

MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK      1 - 70
TLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLG     71 - 140
LNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLV    141 - 210
CCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK                                  211 - 250
//

Text Mined References (7)

PMID Year Title