Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.48
PubTator Score 8.74

Knowledge Summary

Patent (1,437)

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
interstitial cystitis 1.100 1.9e-03
lung adenocarcinoma -1.200 2.9e-13
lung carcinoma -2.100 1.2e-12
mucosa-associated lymphoid tissue lympho... 1.572 1.4e-02
non-small cell lung carcinoma -1.400 1.6e-21
osteosarcoma -2.522 8.4e-06
psoriasis 2.000 4.7e-12

Gene RIF (5)

AA Sequence

MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINE      1 - 70
CTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFE     71 - 140
SLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTF    141 - 210
NLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNV    211 - 280
SLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQ    281 - 350
EEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS    351 - 420
IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLY    421 - 490
GTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFI    491 - 560
LGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSS    561 - 630
KMGPDSKPSEGDVFPGQVKRKY                                                    631 - 652
//

Text Mined References (11)

PMID Year Title