Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.73
PubTator Score 8.74

Knowledge Summary

Patent (1,437)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.522 0.000
interstitial cystitis 1.100 0.002
lung adenocarcinoma -1.200 0.000
lung carcinoma -2.100 0.000
non-small cell lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.572 0.014
psoriasis 2.000 0.000

Synonym

Accession Q9BY15
Symbols EMR3

Gene

Gene RIF (5)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of egf-like module containing, mucin-like, hormone receptor-like 3 (EMR3) in peptide-treated PBMCs
20827226 Given the poor survival associated with high levels of EMR-3 expression in glioma patients, impetus is provided to explore EMR-3 as a potential therapeutic target.
20625511 Additional transcription changes likely associated with Th2-like eosinophilic inflammation were prominent and included increased EMR1&3.
20237496 Observational study of gene-disease association. (HuGE Navigator)
17108056 The expression of EGF-TM7 receptors on myeloid cells is differentially regulated. EMR3 is the first family member found mainly on granulocytes.

AA Sequence

MQGPLLLPGLCFLLSLFGAVTQKTKTSCAKCPPNASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINE      1 - 70
CTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFE     71 - 140
SLLTNQTLWRTEGRQEISSTATTILRDVESKVLETALKDPEQKVLKIQNDSVAIETQAITDNCSEERKTF    141 - 210
NLNVQMNSMDIRCSDIIQGDTQGPSAIAFISYSSLGNIINATFFEEMDKKDQVYLNSQVVSAAIGPKRNV    211 - 280
SLSKSVTLTFQHVKMTPSTKKVFCVYWKSTGQGSQWSRDGCFLIHVNKSHTMCNCSHLSSFAVLMALTSQ    281 - 350
EEDPVLTVITYVGLSVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLCLFLAHLLFLVGIDRTEPKVLCS    351 - 420
IIAGALHYLYLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHLY    421 - 490
GTADRCWLHLDQGFMWSFLGPVCAIFSANLVLFILVFWILKRKLSSLNSEVSTIQNTRMLAFKATAQLFI    491 - 560
LGCTWCLGLLQVGPAAQVMAYLFTIINSLQGFFIFLVYCLLSQQVQKQYQKWFREIVKSKSESETYTLSS    561 - 630
KMGPDSKPSEGDVFPGQVKRKY                                                    631 - 652
//

Text Mined References (11)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
20827226 2010 EMR-3: a potential mediator of invasive phenotypic variation in glioblastoma and novel therapeutic target.
20625511 2010 Gene transcription changes in asthmatic chronic rhinosinusitis with nasal polyps and comparison to those in atopic dermatitis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17108056 2007 The human EGF-TM7 receptor EMR3 is a marker for mature granulocytes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...