Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.64
PubTator Score 13.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Male infertility 170 4.17 2.1
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.100 0.000

Gene RIF (8)

PMID Text
25994570 Overexpression of TEX101 is associated with breast tumors.
24259048 Clinical assays for ECM1 and TEX101 have the potential to replace most of the diagnostic testicular biopsies and facilitate the prediction of outcome of sperm retrieval procedures, increasing the reliability and success of assisted reproduction techniques
22588436 TEX101 is a cancer-testis (CT) gene useful for detection of CML. It was expressed in 30% of CML patients, but not in healthy donors. Unlike many CT genes, overexpression of TEX101 was not shown to induce immunologic responses in these samples.
22158499 Overexpression of NYD-SP8 in various nasopharyngeal carcinoma cell lines indicated its complicated functions, and that it could play an important role in nasopharyngeal carcinoma carcinogenesis.
21933954 Combination of two proteins, SPAG11B and TEX101, can be used for differential diagnosis of azoospermia
19886887 The SPATA19 and TEX101 genes may be possible targets for cancer immunotherapy and novel markers for early detection of basal cell carcinoma.
19153666 identification & function of a novel sperm GPI-anchored membrane protein, NYD-SP8; release of NYD-SP8 during sperm-egg interaction & binding to cumulus elicits cross-talk between the gametes leading to the acrosome reaction
19017363 NYD-SP8 has a role in regulating ECM degradation, providing a novel mechanism that modulates urokinase signalling in the suppression of cancer progression

AA Sequence

MGTPRIQHLLILLVLGASLLTSGLELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAG      1 - 70
TETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHC     71 - 140
PTCVALGTCFSAPSLPCPNGTTRCYQGKLEITGGGIESSVEVKGCTAMIGCRLMSGILAVGPMFVREACP    141 - 210
HQLLTQPRKTENGATCLPIPVWGLQLLLPLLLPSFIHFS                                   211 - 249
//

Text Mined References (15)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
25994570 2015 Transcriptome analysis of the cancer/testis genes, DAZ1, AURKC, and TEX101, in breast tumors and six breast cancer cell lines.
25293881 2015 The contribution of common genetic variation to nicotine and cotinine glucuronidation in multiple ethnic/racial populations.
24259048 2013 Differential diagnosis of azoospermia with proteomic biomarkers ECM1 and TEX101 quantified in seminal plasma.
22588436 Expression of testis-specific genes, TEX101 and ODF4, in chronic myeloid leukemia and evaluation of TEX101 immunogenicity.
22158499 Preparation of anti-NYD-SP8 rabbit polyclonal antibody and its application in the analysis of NYD-SP8 expression in nasopharyngeal carcinoma cell lines and clinical tissues.
21933954 2011 Verification of male infertility biomarkers in seminal plasma by multiplex selected reaction monitoring assay.
19886887 2010 Elevated expression levels of testis-specific genes TEX101 and SPATA19 in basal cell carcinoma and their correlation with clinical and pathological features.
19153666 2009 A sperm GPI-anchored protein elicits sperm-cumulus cross-talk leading to the acrosome reaction.
19017363 2009 A suppressor of multiple extracellular matrix-degrading proteases and cancer metastasis.
More...