Property Summary

NCBI Gene PubMed Count 15
PubMed Score 22.80
PubTator Score 13.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.100 4.0e-190

Gene RIF (8)

AA Sequence

MGTPRIQHLLILLVLGASLLTSGLELYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAG      1 - 70
TETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTASTVSTTLHC     71 - 140
PTCVALGTCFSAPSLPCPNGTTRCYQGKLEITGGGIESSVEVKGCTAMIGCRLMSGILAVGPMFVREACP    141 - 210
HQLLTQPRKTENGATCLPIPVWGLQLLLPLLLPSFIHFS                                   211 - 249
//

Text Mined References (15)

PMID Year Title