Property Summary

NCBI Gene PubMed Count 33
Grant Count 6
R01 Count 1
Funding $489,898.84
PubMed Score 44.31
PubTator Score 27.04

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (9)

PMID Text
24751538 syndapin I functions reflected direct, SH3 domain-mediated associations and functional interactions with ProSAP1/Shank2.
24205826 Specifically, CKS1B and MAP2K5 significantly inhibited hepatitis C viral RNA replication. PACSIN1, by contrast, inhibited hepatitis C virus infection by decreasing the level of viral protein p7.
23898200 Data indicate that the structural capacity of N17 to fold back toward distal regions within huntingtin requires an interacting protein, protein kinase C and casein kinase 2 substrate in neurons 1 (PACSIN1).
23236520 Pacsin-1 plays a versatile role in sculpting cellular membranes that is likely dependent both on protein structure and membrane properties.
22488361 PACSIN1 represents a pDC-specific adaptor molecule that plays an important role in the TLR7/9-mediated type I IFN responses by pDCs in vitro and in vivo.
22355135 Phosphorylation of syndapin I F-BAR domain at two helix-capping motifs regulates membrane tubulation
20057076 PACSIN 1 (1-344) was crystallized & diffracted to resolution of 3.0 A. The crystal belonged to space group C2, with unit-cell parameters a=158.65, b=87.38, c=91.76 A, alpha=90.00, beta=113.61, gamma=90.00 degrees. There are 2 molecules in asymmetric unit.
19549836 The regulated deformation of membranes and promotion of tubule constrictions by Pacsin suggests a more versatile function of these proteins in vesiculation and endocytosis.
18649358 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQL      1 - 70
IEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFR     71 - 140
KAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYE    141 - 210
KVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADA    211 - 280
QEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSY    281 - 350
DRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE    351 - 420
QGWCRGRLDSGQLGLYPANYVEAI                                                  421 - 444
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24751538 2014 ProSAP1 and membrane nanodomain-associated syndapin I promote postsynapse formation and function.
24205826 2014 Identification of novel human kinases that suppress hepatitis C virus infection.
23898200 2013 Polyglutamine domain flexibility mediates the proximity between flanking sequences in huntingtin.
23236520 2012 Versatile membrane deformation potential of activated pacsin.
22573331 2012 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules.
22488361 2012 PACSIN1 regulates the TLR7/9-mediated type I interferon response in plasmacytoid dendritic cells.
22355135 2012 Phosphorylation of syndapin I F-BAR domain at two helix-capping motifs regulates membrane tubulation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20936779 2010 A human MAP kinase interactome.
More...