Property Summary

NCBI Gene PubMed Count 33
PubMed Score 47.73
PubTator Score 27.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.000 5.6e-05
astrocytic glioma -2.600 7.4e-03
Astrocytoma, Pilocytic -1.400 3.4e-05
atypical teratoid / rhabdoid tumor -2.200 1.3e-10
ependymoma -3.600 5.7e-04
glioblastoma -1.400 1.3e-06
group 3 medulloblastoma -3.200 1.3e-04
inflammatory breast cancer 1.300 3.9e-02
intraductal papillary-mucinous adenoma (... -1.100 2.9e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.0e-02
medulloblastoma, large-cell -2.200 2.4e-05
oligodendroglioma -2.100 3.0e-02
osteosarcoma -1.047 8.3e-04
pituitary cancer 1.600 8.8e-05
primitive neuroectodermal tumor -1.900 1.8e-06
subependymal giant cell astrocytoma -3.466 2.7e-02

Protein-protein Interaction (8)

Gene RIF (9)

AA Sequence

MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERAKIEKAYGQQLTDWAKRWRQL      1 - 70
IEKGPQYGSLERAWGAIMTEADKVSELHQEVKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFR     71 - 140
KAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQDVQKTQEKYE    141 - 210
KVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADA    211 - 280
QEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSY    281 - 350
DRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDE    351 - 420
QGWCRGRLDSGQLGLYPANYVEAI                                                  421 - 444
//

Text Mined References (35)

PMID Year Title