Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.85
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -2.200 2.4e-05
Endometriosis -1.165 2.4e-02
interstitial cystitis -2.700 6.6e-04
lung adenocarcinoma -1.600 9.5e-09
lung carcinoma -1.200 6.2e-17
non-small cell lung cancer -2.731 4.6e-27
osteosarcoma -1.774 1.5e-06
psoriasis -1.600 2.1e-21
tuberculosis 2.800 1.5e-06
urothelial carcinoma -3.200 8.4e-20

Gene RIF (2)

AA Sequence

MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQ      1 - 70
QRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAA     71 - 140
ALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTA    141 - 210
CSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHK    211 - 280
TTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTM    281 - 350
IMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV    351 - 420
VTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK                   421 - 475
//

Text Mined References (11)

PMID Year Title