Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.85
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.95787341247632E-48
non-small cell lung cancer 2798 4.64034846003316E-27
urothelial carcinoma 318 8.43088868717999E-20
lung carcinoma 2844 6.2432769300991E-17
lung adenocarcinoma 2714 9.50954875705052E-9
osteosarcoma 7933 1.49141538447523E-6
tuberculosis 1563 1.52145429009346E-6
interstitial cystitis 2299 5.38345363102082E-6
Atopic dermatitis 944 2.43727901296754E-5
Endometriosis 535 0.0242429058455467

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -3.200 0.000
osteosarcoma -1.774 0.000
Atopic dermatitis -2.200 0.000
tuberculosis 2.800 0.000
non-small cell lung cancer -2.731 0.000
interstitial cystitis -3.200 0.000
psoriasis -2.000 0.000
lung adenocarcinoma -1.600 0.000
Endometriosis -1.165 0.024
lung carcinoma -1.200 0.000

Synonym

Accession Q9BY10 B1ALK1 Q86VT0 Q96NE2
Symbols Ly110
TSCOT

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
18392855 Affected sib-pairs with cervical cancer susceptibility and high mean age at diagnosis show increased sharing at all microsatellite markers at 9q31.1-33.1 and linkage signals of up to maximum lod-score of 2.74 for TSCOT single nucleotide polymorphisms.

AA Sequence

MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQ      1 - 70
QRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAA     71 - 140
ALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTA    141 - 210
CSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHK    211 - 280
TTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTM    281 - 350
IMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV    351 - 420
VTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK                   421 - 475
//

Text Mined References (10)

PMID Year Title
18392855 2008 Polymorphisms in 9q32 and TSCOT are linked to cervical cancer in affected sib-pairs with high mean age at diagnosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12826694 A putative 12-transmembrane domain cotransporter associated with apical membranes of the epididymal duct.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10978518 2000 Characterization of the mouse gene, human promoter and human cDNA of TSCOT reveals strong interspecies homology.
10706709 2000 A putative 12 transmembrane domain cotransporter expressed in thymic cortical epithelial cells.