Property Summary

NCBI Gene PubMed Count 5
Grant Count 5
R01 Count 5
Funding $166,816.9
PubMed Score 3.89
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12760743 encoded by four exons on human chromosome 13q14.2 covering 30.7 kb, and a partially processed EBPL pseudogene was found on 16q21; expressed ubiquitously and most abundant in liver, lung and kidney

AA Sequence

MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNV      1 - 70
ANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELY     71 - 140
GCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ        141 - 206
//

Text Mined References (6)

PMID Year Title
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12760743 2003 Cloning of an emopamil-binding protein (EBP)-like protein that lacks sterol delta8-delta7 isomerase activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.