Property Summary

Ligand Count 5
NCBI Gene PubMed Count 5
PubMed Score 4.89
PubTator Score 0.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MGAEWELGAEAGGSLLLCAALLAAGCALGLRLGRGQGAADRGALIWLCYDALVHFALEGPFVYLSLVGNV      1 - 70
ANSDGLIASLWKEYGKADARWVYFDPTIVSVEILTVALDGSLALFLIYAIVKEKYYRHFLQITLCVCELY     71 - 140
GCWMTFLPEWLTRSPNLNTSNWLYCWLYLFFFNGVWVLIPGLLLWQSWLELKKMHQKETSSVKKFQ        141 - 206
//

Text Mined References (6)

PMID Year Title