Property Summary

NCBI Gene PubMed Count 16
Grant Count 6
R01 Count 5
Funding $1,699,899.25
PubMed Score 17.19
PubTator Score 29.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (10)

PMID Text
26447209 NBCe2 could be important in proximal kidney tubule apical sodium and bicarbonate cotransport under high-salt conditions.
26136555 we summarize the potential function of NBCe2 in the regulation of blood pressure, acid-base, and K(+) and Ca(2+) transport in the distal nephron--{REVIEW}
22987918 Data indicate that 2 SNPs in SLC4A5 (rs7571842 and rs10177833) showed highly significant results and large effects sizes.
22764636 The additive effect of rs10177833 of SLC4A5 on systolic blood pressure is statistically different between women with dark skin color and women with medium skin color (P = .0153).
19487301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19384345 Summarizing, the observed associations with resting and submaximal-exercise cardiovascular and metabolic traits in the HERITAGE Family Study are likely due to neither variation in the promoter nor known coding SNPs of SLC4A5
19384345 Observational study of gene-disease association. (HuGE Navigator)
16365189 Observational study of gene-disease association. (HuGE Navigator)
16365189 These results additionally confirm the involvement of SLC4A5 with blood pressure control, although the mechanism is still unclear.
12063394 Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued).

AA Sequence

MKVKEEKAGVGKLDHTNHRRRFPDQKECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQEL      1 - 70
TGPGSGASSQDSSMDLISRTRSPAAEQLQDILGEEDEAPNPTLFTEMDTLQHDGDQMEWKESARWIKFEE     71 - 140
KVEEGGERWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDSGSLPQIIDDVIEKQIEDGLLRPELRERVSY    141 - 210
VLLRRHRHQTKKPIHRSLADIGKSVSTTNRSPARSPGAGPSLHHSTEDLRMRQSANYGRLCHAQSRSMND    211 - 280
ISLTPNTDQRKNKFMKKIPKDSEASNVLVGEVDFLDQPFIAFVRLIQSAMLGGVTEVPVPTRFLFILLGP    281 - 350
SGRAKSYNEIGRAIATLMVDDLFSDVAYKARNREDLIAGIDEFLDEVIVLPPGEWDPNIRIEPPKKVPSA    351 - 420
DKRKSVFSLAELGQMNGSVGGGGGAPGGGNGGGGGGGSGGGAGSGGAGGTSSGDDGEMPAMHEIGEELIW    421 - 490
TGRFFGGLCLDIKRKLPWFPSDFYDGFHIQSISAILFIYLGCITNAITFGGLLGDATDNYQGVMESFLGT    491 - 560
AMAGSLFCLFSGQPLIILSSTGPILIFEKLLFDFSKGNGLDYMEFRLWIGLHSAVQCLILVATDASFIIK    561 - 630
YITRFTEEGFSTLISFIFIYDAIKKMIGAFKYYPINMDFKPNFITTYKCECVAPDTVNTTVFNASAPLAP    631 - 700
DTNASLYNLLNLTALDWSLLSKKECLSYGGRLLGNSCKFIPDLALMSFILFFGTYSMTLTLKKFKFSRYF    701 - 770
PTKVRALVADFSIVFSILMFCGIDACFGLETPKLHVPSVIKPTRPDRGWFVAPFGKNPWWVYPASILPAL    771 - 840
LVTILIFMDQQITAVIVNRKENKLKKAAGYHLDLFWVGILMALCSFMGLPWYVAATVISIAHIDSLKMET    841 - 910
ETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPILKCIPLPVLYGVFLYMGVASLNGIQMGTGGSEF    911 - 980
KIQKKLTPFWERCKLFLMPAKHQPDHAFLRHVPLRRIHLFTLVQILCLAVLWILKSTVAAIIFPVMILGL    981 - 1050
IIVRRLLDFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQN   1051 - 1120
GIHCIARKRSSSWSYSL                                                        1121 - 1137
//

Text Mined References (19)

PMID Year Title
26447209 2015 The sodium-bicarbonate cotransporter NBCe2 (slc4a5) expressed in human renal proximal tubules shows increased apical expression under high-salt conditions.
26136555 2015 Physiological role of NBCe2 in the regulation of electrolyte transport in the distal nephron.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
22987918 2012 Salt sensitivity of blood pressure is associated with polymorphisms in the sodium-bicarbonate cotransporter.
22764636 2012 Gene-environment effects of SLC4A5 and skin color on blood pressure among African American women.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
19487301 2009 Genetic and environmental risks for high blood pressure among African American mothers and daughters.
19384345 2009 Functional identification of the promoter of SLC4A5, a gene associated with cardiovascular and metabolic phenotypes in the HERITAGE Family Study.
17715183 2007 Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues.
16365189 2006 Sodium bicarbonate cotransporter polymorphisms are associated with baseline and 10-year follow-up blood pressures.
More...