Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.34
PubTator Score 18.80

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25490384 Bex2 affects the invasion and migration ability of glioma cells by regulating beta-catenin
23022184 Bex2 may be an important player during the development of glioma
22907646 Bex2 overexpression promoted cell migration and invasion in glioma cell lines.
22698742 Both BEX2 and INI1/hSNF5 mainly localized in cell nucleus.
21384344 BEX2 overexpression was associated with breast cancer.
20482821 BEX2 has a functional interplay with c-Jun and p65/RelA in breast cancer.
19835597 These results suggest that the conspicuous expression of the tumor suppressor genes BEX2, IGSF4 and TIMP3 in MLLmu acute myeloid leukemias cell lines is the consequence of altered epigenetic properties of MLL fusion proteins.
19412433 BEX2 is implicated in oligodendroglioma biology.
17638883 a NGF/BEX2/NF-kappaB pathway is involved in regulating apoptosis in breast cancer cells and in modulating response to tamoxifen in primary tumors
17251904 Correlation between BEX2 expression and mixed lineage leukemia chromosomal aberrations are shown in the cell lines.
More...

AA Sequence

MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIM      1 - 70
HRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP                 71 - 128
//

Text Mined References (22)

PMID Year Title
25490384 2015 ?-catenin is involved in Bex2 down-regulation induced glioma cell invasion/migration inhibition.
25416956 2014 A proteome-scale map of the human interactome network.
23022184 2012 Bex2 regulates cell proliferation and apoptosis in malignant glioma cells via the c-Jun NH2-terminal kinase pathway.
22907646 2013 Bex2 is critical for migration and invasion in malignant glioma cells.
22698742 2012 [BEX2 regulates cell cycle through the interaction with INI1/hSNF5].
21384344 2012 A feedback loop between BEX2 and ErbB2 mediated by c-Jun signaling in breast cancer.
20482821 2010 BEX2 has a functional interplay with c-Jun/JNK and p65/RelA in breast cancer.
19835597 2009 Hypomethylation and expression of BEX2, IGSF4 and TIMP3 indicative of MLL translocations in acute myeloid leukemia.
19711341 2010 BEX2 regulates mitochondrial apoptosis and G1 cell cycle in breast cancer.
19412433 2009 Galectin 1 proangiogenic and promigratory effects in the Hs683 oligodendroglioma model are partly mediated through the control of BEX2 expression.
More...