Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.72
PubTator Score 18.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -2.100 1.3e-02
adult high grade glioma -1.300 5.9e-04
astrocytic glioma -1.600 4.3e-03
atypical teratoid / rhabdoid tumor -1.800 2.7e-03
Breast cancer -2.500 2.2e-08
breast carcinoma -1.200 8.6e-15
cystic fibrosis 1.792 1.7e-06
ependymoma -2.500 2.4e-03
glioblastoma -1.200 9.2e-06
interstitial cystitis -1.400 2.4e-02
intraductal papillary-mucinous adenoma (... -1.100 6.3e-03
intraductal papillary-mucinous carcinoma... -1.700 3.0e-02
intraductal papillary-mucinous neoplasm ... -3.000 2.4e-02
juvenile dermatomyositis 1.649 7.9e-09
lung adenocarcinoma -1.100 2.1e-02
lung carcinoma 1.300 3.1e-28
medulloblastoma, large-cell -1.300 4.9e-03
oligodendroglioma -1.500 3.5e-02
ovarian cancer -2.000 6.1e-05
pancreatic cancer -1.200 6.6e-03
Pick disease -1.300 1.1e-02
sarcoidosis -1.200 3.5e-04
sonic hedgehog group medulloblastoma -1.500 3.2e-02
subependymal giant cell astrocytoma -2.561 3.0e-02

Synonym

Accession Q9BXY8 B2R574 D3DXA2 F5H7H5 Q5JVV9
Symbols BEX1
DJ79P11.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MESKEERALNNLIVENVNQENDEKDEKEQVANKGEPLALPLNVSEYCVPRGNRRRFRVRQPILQYRWDIM      1 - 70
HRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP                 71 - 128
//

Text Mined References (23)

PMID Year Title