Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.20
PubTator Score 11.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma 1.300 1.7e-02
chronic rhinosinusitis -1.251 2.3e-02
cystic fibrosis and chronic rhinosinusit... -1.488 1.5e-02
ependymoma 1.700 1.7e-02
lung adenocarcinoma -1.300 3.5e-13
medulloblastoma, large-cell -2.300 1.3e-04
nasopharyngeal carcinoma -2.000 1.3e-04
ovarian cancer -1.400 1.8e-05
sarcoidosis 1.700 2.1e-02

Gene RIF (1)

AA Sequence

MGNSFCYTAVYCMINTGTQMDLEVKGVAATSRSQIQPFFGRKKPLQQRWTSESWTNQNSCPPVVPRLDLG      1 - 70
SLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCK     71 - 140
TEIKEGYKQYSQRNAENTKSNVTHKQSPRNKIDEKCVQDEEANTDDLTTLDRKAILQQGYADNSCDKQQR    141 - 210
ARKLDAEIVAAEKKKQIVAEQVMIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKI    211 - 280
RTHSTLTENVLSHKLQFDGRIVSRNGRDACRELIGFFFTHDQSLTIYEYRQFGKNRTNVLPFIQKSIYSH    281 - 350
QCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQ    351 - 420
ETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAW    421 - 490
LILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG       491 - 557
//

Text Mined References (8)

PMID Year Title