Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.20
PubTator Score 11.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.700 0.017
medulloblastoma, large-cell -2.300 0.000
adrenocortical carcinoma 1.300 0.017
sarcoidosis 1.700 0.021
lung adenocarcinoma -1.300 0.000
nasopharyngeal carcinoma -2.000 0.000
ovarian cancer -1.400 0.000
chronic rhinosinusitis -2.433 0.007
cystic fibrosis and chronic rhinosinusit... -1.651 0.021

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif downregulates the expression of calcyphosine 2 protein (CAPS2) in Vif-expression T cells

AA Sequence

MGNSFCYTAVYCMINTGTQMDLEVKGVAATSRSQIQPFFGRKKPLQQRWTSESWTNQNSCPPVVPRLDLG      1 - 70
SLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCK     71 - 140
TEIKEGYKQYSQRNAENTKSNVTHKQSPRNKIDEKCVQDEEANTDDLTTLDRKAILQQGYADNSCDKQQR    141 - 210
ARKLDAEIVAAEKKKQIVAEQVMIDHLSRAVISDPEQNLAIEQKESDHILPDSKMTPLRFRKRTLHETKI    211 - 280
RTHSTLTENVLSHKLQFDGRIVSRNGRDACRELIGFFFTHDQSLTIYEYRQFGKNRTNVLPFIQKSIYSH    281 - 350
QCGRRKGKQYRLGDFYVGATLTFLSSDHLSLPESIKENTLLKLRITNIDQIALDSLKTASMEQEDDIIIQ    351 - 420
ETNDRLVFKAIQDVLKEKLHKRGVRILTGLGKYFQQLDKEGNGLLDKADFKQALKVFHLEVSEKDFESAW    421 - 490
LILNDNGNGKVDYGEFKRGIIGEMNEYRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISG       491 - 557
//

Text Mined References (8)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14530279 2003 A family of Ca2+-dependent activator proteins for secretion: comparative analysis of structure, expression, localization, and function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11846421 2002 Cloning, characterization, and expression of calcyphosine 2, a novel human gene encoding an EF-hand Ca(2+)-binding protein.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
1184642 1975 Rheumatoid wrist deformities and their relation to ulnar drift.