Property Summary

NCBI Gene PubMed Count 37
PubMed Score 23.21
PubTator Score 16.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy -1.053 6.1e-03
adrenocortical carcinoma -4.340 1.0e-10
adult high grade glioma -1.500 2.0e-04
astrocytic glioma -1.500 6.6e-03
Astrocytoma, Pilocytic -2.100 3.7e-09
Breast cancer -1.300 3.6e-06
breast carcinoma -1.100 2.8e-03
cystic fibrosis 1.600 1.8e-02
ependymoma -1.300 2.1e-03
fibroadenoma -1.100 2.8e-02
glioblastoma -1.800 1.7e-07
group 3 medulloblastoma 2.600 1.9e-02
interstitial cystitis 1.500 6.9e-03
intraductal papillary-mucinous adenoma (... -2.500 2.2e-04
intraductal papillary-mucinous carcinoma... -2.500 4.1e-04
intraductal papillary-mucinous neoplasm ... -2.400 6.3e-03
invasive ductal carcinoma -1.428 5.7e-03
limb girdle muscular dystrophy 2A -1.175 1.5e-03
lung carcinoma -1.200 5.3e-08
non-small cell lung cancer -1.248 2.6e-07
oligodendroglioma -1.800 2.9e-03
ovarian cancer -2.000 1.6e-02
pituitary cancer -1.300 4.1e-03
primitive neuroectodermal tumor -2.500 2.3e-06
psoriasis -1.200 5.3e-04
ulcerative colitis 1.200 2.2e-02

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGM      1 - 70
KQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTM     71 - 140
ECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGE    141 - 210
RGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH            211 - 272
//

Text Mined References (39)

PMID Year Title