Property Summary

NCBI Gene PubMed Count 33
Grant Count 3
R01 Count 2
Funding $430,101.34
PubMed Score 17.34
PubTator Score 16.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BXY4 B2RC27 Q5VTV4 Q96K87
Symbols PWTSR
THSD2
CRISTIN1

Gene

Gene RIF (9)

PMID Text
26733130 A genome-wide association study of bone mineral density (BMD) found a new BMD locus that harbors the PTCH1 gene, that associates with reduced spine BMD and the RSPO3 associates with increased spine BMD.
25531322 These findings suggest that aberrant RSPO3-LGR4 signaling potentially acts as a driving mechanism in the aggressiveness of Keap1-deficient lung ADs.
24847761 results suggest that the expression of RSPO fusion transcripts is related to a subset of colorectal cancers arising in the Japanese population
22895193 using RNA-seq data, identification of multiple fusion transcripts including recurrent gene fusions involving R-spondin family members RSPO2 and RSPO3 that together occur in 10% of colon tumours
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
12643280 a polymorphism in thrombospondin subtly but significantly sensitizes the calcium-binding repeats to removal of Ca2+ and thermal denaturation
12463421 the gene is a novel member of thrombospondin type I repeat supergene family (hPWTSR)

AA Sequence

MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGM      1 - 70
KQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTM     71 - 140
ECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGE    141 - 210
RGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH            211 - 272
//

Text Mined References (35)

PMID Year Title
26766444 2016 Endothelial RSPO3 Controls Vascular Stability and Pruning through Non-canonical WNT/Ca(2+)/NFAT Signaling.
26733130 2016 Sequence variants in the PTCH1 gene associate with spine bone mineral density and osteoporotic fractures.
25531322 2015 Aberrant RSPO3-LGR4 signaling in Keap1-deficient lung adenocarcinomas promotes tumor aggressiveness.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24847761 2014 RSPO fusion transcripts in colorectal cancer in Japanese population.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24430505 2014 Genetic determinants of heel bone properties: genome-wide association meta-analysis and replication in the GEFOS/GENOMOS consortium.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
More...