Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.33
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.4e-04
lung cancer 4740 2.7e-02

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.7e-02
ovarian cancer -1.100 4.4e-04

 GO Function (1)

AA Sequence

MQSDDVIWDTLGNKQFCSFKIRTKTQSFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYMKVIER      1 - 70
AAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKK     71 - 140
VERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQEAESDSSDTEEKDDDDD    141 - 210
DEEDVGKREFVEDGEVDESDISDFEDMDKLDASSDEDQDGKSSSEEEEEKALSAKHKGKMPLRGPLQRKR    211 - 280
AYVEIEYEQETEPVAKAKTT                                                      281 - 300
//

Text Mined References (17)

PMID Year Title