Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
Funding $420,870
PubMed Score 19.49
PubTator Score 22.88

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
invasive ductal carcinoma 2.700 0.022
psoriasis -1.600 0.000

Gene RIF (10)

PMID Text
26415367 Results revealed a significant difference in NY-BR-1 Ag expression between benign and malignant breast cancer patients
23731661 The exclusive expression of Cancer-testis antigens in tumor tissues as well as the frequent expression of NY-BR-1 could define new targets for specific breast cancer therapies.
18976975 Knockdown of ankyrin repeat domain 30A (ANKRD30A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of ankyrin repeat domain 30A (ANKRD30A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18041742 We identified estrogen-response element (ERE)-like sequences nearby the NY-BR-1 promoter region, suggesting that NY-BR-1 expression might be regulated through estrogen receptors.
17536312 testing demonstrates NY-BR-1 in a mostly focal fashion in the epithelia of ducts and acini of the mammary gland. In tumors, homogenous staining can be seen in almost all ductal carcinomas in situ and/or the intraductal component of invasive carcinomas.
17330232 The strong expression of NY-BR-1 in breast tumors, its cytoplasmic and membrane localization and accessibility to an ectopically applied antibody now suggest to pursue NY-BR-1 as a potential target for antibody-based therapies in breast cancer patients.
16675566 NY-BR-1 is a differentiation antigen of the breast, which is present in normal and tumorous mammary epithelium.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16335914 In this study we extended the expression analysis to various other normal and tumor tissues and found inconsistent expression of NY-BR-1 in normal prostate, but consistent NY-BR-1 mRNA expression in 32% of prostate cancers, but not in other tumor types

AA Sequence

MEEISAAAVKVVPGPERPSPFSQLVYTSNDSYIVHSGDLRKIHKAASRGQVRKLEKMTKRKKTINLNIQD      1 - 70
AQKRTALHWACVNGHEEVVTFLVDRKCQLDVLDGEHRTPLMKALQCHQEACANILIDSGADINLVDVYGN     71 - 140
TALHYAVYSEILSVVAKLLSHGAVIEVHNKASLTPLLLSITKRSEQIVEFLLIKNANANAVNKYKCTALM    141 - 210
LAVCHGSSEIVGMLLQQNVDVFAADICGVTAEHYAVTCGFHHIHEQIMEYIRKLSKNHQNTNPEGTSAGT    211 - 280
PDEAAPLAERTPDTAESLVEKTPDEAAPLVERTPDTAESLVEKTPDEAASLVEGTSDKIQCLEKATSGKF    281 - 350
EQSAEETPREITSPAKETSEKFTWPAKGRPRKIAWEKKEDTPREIMSPAKETSEKFTWAAKGRPRKIAWE    351 - 420
KKETPVKTGCVARVTSNKTKVLEKGRSKMIACPTKESSTKASANDQRFPSESKQEEDEEYSCDSRSLFES    421 - 490
SAKIQVCIPESIYQKVMEINREVEEPPKKPSAFKPAIEMQNSVPNKAFELKNEQTLRADPMFPPESKQKD    491 - 560
YEENSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEESPNKDGLLKATCGMKVSIPTKALELKDMQT    561 - 630
FKAEPPGKPSAFEPATEMQKSVPNKALELKNEQTLRADEILPSESKQKDYEENSWDTESLCETVSQKDVC    631 - 700
LPKAAHQKEIDKINGKLEGSPVKDGLLKANCGMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKS    701 - 770
VPNKALELKNEQTLRADEILPSESKQKDYEESSWDSESLCETVSQKDVCLPKATHQKEIDKINGKLEESP    771 - 840
DNDGFLKAPCRMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFP    841 - 910
SESKQKKVEENSWDSESLRETVSQKDVCVPKATHQKEMDKISGKLEDSTSLSKILDTVHSCERARELQKD    911 - 980
HCEQRTGKMEQMKKKFCVLKKKLSEAKEIKSQLENQKVKWEQELCSVRLTLNQEEEKRRNADILNEKIRE    981 - 1050
ELGRIEEQHRKELEVKQQLEQALRIQDIELKSVESNLNQVSHTHENENYLLHENCMLKKEIAMLKLEIAT   1051 - 1120
LKHQYQEKENKYFEDIKILKEKNAELQMTLKLKEESLTKRASQYSGQLKVLIAENTMLTSKLKEKQDKEI   1121 - 1190
LEAEIESHHPRLASAVQDHDQIVTSRKSQEPAFHIAGDACLQRKMNVDVSSTIYNNEVLHQPLSEAQRKS   1191 - 1260
KSLKINLNYAGDALRENTLVSEHAQRDQRETQCQMKEAEHMYQNEQDNVNKHTEQQESLDQKLFQLQSKN   1261 - 1330
MWLQQQLVHAHKKADNKSKITIDIHFLERKMQHHLLKEKNEEIFNYNNHLKNRIYQYEKEKAETENS      1331 - 1397
//

Text Mined References (19)

PMID Year Title
26415367 2015 NY-BR-1 Antigen Expression and anti-NY-BR-1 IgG in Egyptian Breast Cancer Patients: Clinicopathological and Prognostic Significance.
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
23731661 2013 Cancer testis antigens and NY-BR-1 expression in primary breast cancer: prognostic and therapeutic implications.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18041742 2008 Distinct expression patterns of the immunogenic differentiation antigen NY-BR-1 in normal breast, testis and their malignant counterparts.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
17536312 2007 NY-BR-1 is a differentiation antigen of the mammary gland.
More...