Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 1.7e-14
malignant mesothelioma 3232 3.4e-07
tuberculosis 2010 1.5e-05
ovarian cancer 8520 4.1e-05
psoriasis 6694 1.7e-04
group 3 medulloblastoma 4104 2.6e-04
lung cancer 4740 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.6e-04
lung cancer 1.300 1.9e-03
malignant mesothelioma 1.400 3.4e-07
non-small cell lung cancer 1.105 1.7e-14
ovarian cancer 1.300 4.1e-05
psoriasis 1.200 1.7e-04
tuberculosis 1.100 1.5e-05

Synonym

Accession Q9BXW7 B2RCK5 Q9BXW8 Q9NWA8 Q9NX41
Symbols CECR5

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAAWGCVAALGAARGLCWRAARAAAGLQGRPARRCYAVGPAQSPPTFGFLLDIDGVLVRGHRVIPAALKA      1 - 70
FRRLVNSQGQLRVPVVFVTNAGNILQHSKAQELSALLGCEVDADQVILSHSPMKLFSEYHEKRMLVSGQG     71 - 140
PVMENAQGLGFRNVVTVDELRMAFPLLDMVDLERRLKTTPLPRNDFPRIEGVLLLGEPVRWETSLQLIMD    141 - 210
VLLSNGSPGAGLATPPYPHLPVLASNMDLLWMAEAKMPRFGHGTFLLCLETIYQKVTGKELRYEGLMGKP    211 - 280
SILTYQYAEDLIRRQAERRGWAAPIRKLYAVGDNPMSDVYGANLFHQYLQKATHDGAPELGAGGTRQQQP    281 - 350
SASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEGW    351 - 420
ALE                                                                       421 - 423
//

Text Mined References (9)

PMID Year Title