Property Summary

NCBI Gene PubMed Count 23
PubMed Score 5.13
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.768 2.3e-02
adult high grade glioma -3.100 3.1e-06
astrocytic glioma -2.700 3.5e-03
Astrocytoma, Pilocytic -2.100 6.6e-05
Atopic dermatitis -1.100 3.8e-05
atypical teratoid / rhabdoid tumor -2.300 8.9e-04
colon cancer -1.600 5.3e-04
cystic fibrosis 1.269 3.4e-05
ductal carcinoma in situ -1.700 1.1e-03
ependymoma -2.200 1.8e-02
glioblastoma -2.200 1.7e-06
group 3 medulloblastoma -2.300 5.4e-03
intraductal papillary-mucinous neoplasm ... -1.600 4.3e-02
invasive ductal carcinoma -2.100 7.3e-04
lung cancer -1.300 3.1e-02
malignant mesothelioma -2.600 1.0e-07
medulloblastoma, large-cell 1.100 5.5e-04
oligodendroglioma -1.800 2.1e-02
ovarian cancer 1.100 6.1e-10
pituitary cancer -1.800 1.2e-03
primitive neuroectodermal tumor -2.700 1.7e-04
psoriasis -2.000 4.6e-05
spina bifida -1.825 2.3e-02
tuberculosis 2.500 3.9e-09

Gene RIF (13)

AA Sequence

MNTEAEQQLLHHARNGNAEEVRQLLETMARNEVIADINCKGRSKSNLGWTPLHLACYFGHRQVVQDLLKA      1 - 70
GAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTIVNGSGQTAKEVTHAEEIRSMLEAVERTQQRK     71 - 140
LEELLLAAAREGKTTELTALLNRPNPPDVNCSDQLGNTPLHCAAYRAHKQCALKLLRSGADPNLKNKNDQ    141 - 210
KPLDLAQGAEMKHILVGNKVIYKALKRYEGPLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNIYRQG    211 - 280
CKHLTQAVCTVKSTDSCLFFIKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEE    281 - 350
EDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALTDCLN    351 - 420
LFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILSEDEFYDALSDSESERSLS    421 - 490
RLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSILRKCIGME    491 - 560
LSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLG    561 - 630
ETYELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHN    631 - 700
EAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCA    701 - 770
LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRP    771 - 840
PNSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKS    841 - 910
EEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY                                  911 - 950
//

Text Mined References (29)

PMID Year Title