Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.58
PubTator Score 6.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
astrocytic glioma -2.700 0.004
ependymoma -2.200 0.018
oligodendroglioma -1.800 0.021
psoriasis -2.000 0.000
glioblastoma -3.200 0.000
group 4 medulloblastoma -3.000 0.000
cystic fibrosis 1.269 0.000
atypical teratoid / rhabdoid tumor -2.300 0.001
medulloblastoma, large-cell -4.000 0.000
primitive neuroectodermal tumor -2.700 0.000
Atopic dermatitis -1.100 0.000
tuberculosis 2.500 0.000
intraductal papillary-mucinous neoplasm ... -1.600 0.043
lung cancer -1.800 0.000
colon cancer -1.600 0.001
ulcerative colitis -1.900 0.007
adult high grade glioma -3.100 0.000
pilocytic astrocytoma -2.100 0.000
spina bifida -1.825 0.023
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -2.100 0.001
ovarian cancer -2.000 0.000
pituitary cancer -1.800 0.001

Synonym

Accession Q9BXW6 B7Z7D3 Q9BZF5 Q9NW87 ORP-1
Symbols ORP1
ORP-1
OSBPL1B

Gene

Gene RIF (10)

PMID Text
24025716 Data suggest RIDalpha as a model system for understanding physiological egress routes that use ORP1L to activate endosome-to-endoplasmic reticulum (ER) feedback responses involved in lipid droplets (LDs)formation.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of oxysterol binding protein-like 1A (OSBPL1A) in peptide-treated PBMCs
22728266 ORP1S is a cytoplasmic sterol sensor, which transports sterols to the nucleus and promotes LXR regulated trans-activation of apoE.
20690035 The study shows that OSBPL1A binds several oxysterols and cholesterol, and characterize a mutant, OSBPL1A Delta560-563, defective in oxysterol binding.
20548944 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19564404 Results describe how ORP1L contacts VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
18369178 OSBPL1A was preferentially expressed from the maternal allele
16176980 binds to Rab7, modifies its functional cycle, and can interfere with lysosome organization and endocytic membrane trafficking.
12631712 Results suggest that the two forms of oxysterol binding protein-related protein-1 (ORP1) are functionally distinct and that ORP1L is involved in control of cellular lipid metabolism

AA Sequence

MNTEAEQQLLHHARNGNAEEVRQLLETMARNEVIADINCKGRSKSNLGWTPLHLACYFGHRQVVQDLLKA      1 - 70
GAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTIVNGSGQTAKEVTHAEEIRSMLEAVERTQQRK     71 - 140
LEELLLAAAREGKTTELTALLNRPNPPDVNCSDQLGNTPLHCAAYRAHKQCALKLLRSGADPNLKNKNDQ    141 - 210
KPLDLAQGAEMKHILVGNKVIYKALKRYEGPLWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNIYRQG    211 - 280
CKHLTQAVCTVKSTDSCLFFIKCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEE    281 - 350
EDTVSAADLKKSLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALTDCLN    351 - 420
LFTKQEGVRNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPASILSEDEFYDALSDSESERSLS    421 - 490
RLEAVTARSFEEEGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSILRKCIGME    491 - 560
LSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLG    561 - 630
ETYELVRDDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHN    631 - 700
EAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCA    701 - 770
LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPDSESVFIIPGSVLLWRIAPRP    771 - 840
PNSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKS    841 - 910
EEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY                                  911 - 950
//

Text Mined References (26)

PMID Year Title
24025716 2013 Adenovirus RID? uncovers a novel pathway requiring ORP1L for lipid droplet formation independent of NPC1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22728266 2012 Sterol-dependent nuclear import of ORP1S promotes LXR regulated trans-activation of apoE.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20690035 2011 Sterol binding by OSBP-related protein 1L regulates late endosome motility and function.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19564404 2009 Cholesterol sensor ORP1L contacts the ER protein VAP to control Rab7-RILP-p150 Glued and late endosome positioning.
More...