Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.79
PubTator Score 3.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 2.7e-05
invasive ductal carcinoma 2951 2.3e-04
lung cancer 4740 3.0e-04
psoriasis 6694 3.5e-03
osteosarcoma 7950 5.6e-03
atypical teratoid/rhabdoid tumor 357 7.0e-03
Disease Target Count Z-score Confidence
Birt-Hogg-Dube syndrome 11 3.409 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 7.0e-03
ependymoma 1.400 2.7e-05
invasive ductal carcinoma -1.100 2.3e-04
lung cancer -1.500 3.0e-04
osteosarcoma -1.069 5.6e-03
psoriasis -1.400 3.5e-03

Gene RIF (10)

AA Sequence

MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFL      1 - 70
SIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLE     71 - 140
DRPCNPL                                                                   141 - 147
//

Text Mined References (24)

PMID Year Title