Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
R01 Count 3
Funding $173,240.6
PubMed Score 5.45
PubTator Score 3.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.400 0.004
osteosarcoma -1.069 0.006
posterior fossa group B ependymoma 2.000 0.000
lung cancer -1.500 0.000
atypical teratoid/rhabdoid tumor 1.200 0.007
invasive ductal carcinoma -1.100 0.000

Gene RIF (10)

PMID Text
26431026 Results indicate that TECPR2 Binds LC3and the complex is required for autophagosome formation, possibly through regulation of functional ER exit sites
25847297 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
25490467 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
25490467 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
25490467 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
25490467 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
24300435 both autophagy-related 5 and microtubule-associated protein 1 light chain 3B levels are decreased in patients with melanomas as compared with those with benign nevi
23022382 ccytoplasm against Salmonella.
8997639 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells
2212989 HIV-1 Nef-treated mesenchymal stem cells downregulates the conversion of LC3I to LC3II, reflecting a decrease in autophagic efflux in cells

AA Sequence

MPPPQKIPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFL      1 - 70
SIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETFGCLESAAPRDGSSLE     71 - 140
DRPCNPL                                                                   141 - 147
//

Text Mined References (20)

PMID Year Title
26431026 2015 TECPR2 Cooperates with LC3C to Regulate COPII-Dependent ER Export.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
24668264 2014 Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.
24300435 2014 Autophagy suppresses melanoma tumorigenesis by inducing senescence.
24290141 2014 Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.
23459205 2013 Ubiquilin4 is an adaptor protein that recruits Ubiquilin1 to the autophagy machinery.
23112293 2012 The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation.
23022382 2012 LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy.
22470510 2012 DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.
More...