Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.75849603532163E-18
ovarian cancer 8492 5.07942783774532E-6
Pick disease 1893 1.80824207285728E-4
osteosarcoma 7933 2.11611732294741E-4
medulloblastoma, large-cell 6234 0.00214683031534819
progressive supranuclear palsy 674 0.00433510746861446
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00456821428207428
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00580296080239306
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0163799002816791
group 3 medulloblastoma 2254 0.0306746679392001

Synonym

Accession Q9BXW3
Symbols C1orf79
LINC00100
ASLNC04080
NCRNA00100

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
25695231 These results suggested a potential function of ASLNC04080 in endometrial carcinoma genesis and progression

AA Sequence

MQGTWLPPSFLAVCDTEEVSLFLELCFKIHVTCKAVLICDYGPMELGQSLWEAEGKDPGHFR              1 - 62
//

Text Mined References (4)

PMID Year Title
25695231 2015 Microarray expression profile of lncRNAs and the upregulated ASLNC04080 lncRNA in human endometrial carcinoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.