Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BXW3
Symbols C1orf79
PNAS-123
LINC00100
ASLNC04080
NCRNA00100

Gene

 Compartment GO Term (0)

Gene RIF (3)

AA Sequence

MQGTWLPPSFLAVCDTEEVSLFLELCFKIHVTCKAVLICDYGPMELGQSLWEAEGKDPGHFR              1 - 62
//

Text Mined References (14)

PMID Year Title