Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute myeloid leukemia -1.100 1.6e-02
aldosterone-producing adenoma -1.280 8.8e-03
ependymoma 1.200 8.8e-06
nasopharyngeal carcinoma -1.300 5.0e-05
osteosarcoma 1.740 4.9e-03
pancreatic ductal adenocarcinoma liver m... -1.382 2.2e-03
tuberculosis and treatment for 3 months -1.100 8.8e-04

Synonym

Accession Q9BXV9 Q0D2N1 Q0P6C4 Q3B7W5
Symbols PNAS-127
C14orf142

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDG      1 - 70
DDEDDAEDENNIDNRTNFDGPSAKRPKTPS                                             71 - 100
//

Text Mined References (6)

PMID Year Title