Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BXV9 Q0D2N1 Q0P6C4 Q3B7W5
Symbols PNAS-127
C14orf142

Gene

AA Sequence

MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDG      1 - 70
DDEDDAEDENNIDNRTNFDGPSAKRPKTPS                                             71 - 100
//

Text Mined References (5)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.