Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.50
PubTator Score 10.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ependymoma 2514 2.31065538450814E-21
ovarian cancer 8492 9.0332676112061E-9
adult high grade glioma 2148 1.52857568215176E-7
pilocytic astrocytoma 3086 1.59643337245402E-6
oligodendroglioma 2849 2.39781757337293E-6
group 3 medulloblastoma 2254 4.4773862590035E-6
glioblastoma 5572 8.70272037515533E-5
atypical teratoid / rhabdoid tumor 4369 3.995863305104E-4
medulloblastoma, large-cell 6234 4.64803967695237E-4
subependymal giant cell astrocytoma 2287 0.00293736977621453
primitive neuroectodermal tumor 3031 0.00646984223536408
astrocytic glioma 2241 0.00979491862020809
aldosterone-producing adenoma 664 0.0359700794666875
Disease Target Count Z-score Confidence
Schizophrenia 503 3.002 1.5
Chronic obstructive pulmonary disease 147 0.0 1.0

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.010
glioblastoma -4.400 0.000
oligodendroglioma -1.900 0.000
ependymoma -5.000 0.000
group 3 medulloblastoma -4.700 0.000
atypical teratoid / rhabdoid tumor -3.700 0.000
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -3.200 0.006
adult high grade glioma -4.700 0.000
pilocytic astrocytoma -3.800 0.000
aldosterone-producing adenoma 1.106 0.036
subependymal giant cell astrocytoma -5.385 0.003
ovarian cancer 1.400 0.000

Synonym

Accession Q9BXU9 J3KQA7 CaBP8
Symbols CABP8

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
26206863 detected the first genome-wide significant association of schizophrenia with CALN1, which is a predicted target of MIR137, and thus provide new evidence for the associations between MIR137 targets and schizophrenia
26163462 provide strong evidence that CALN1 is a target of miR-137.
26116628 The protein is most abundant in Purkinje cells of the cerebellum and principal neurons of the cortex and limbic brain whereas no expression in glial cells is apparent.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19338761 CaBP7 and 8 possess a targeting mechanism that is unique amongst the CaBPs that may contribute to differential functional Ca(2+)-sensing by these family members.

AA Sequence

MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY      1 - 70
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL     71 - 140
YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA    141 - 210
NQILRSGME                                                                 211 - 219
//

Text Mined References (19)

PMID Year Title
26206863 2015 Loci with genome-wide associations with schizophrenia in the Han Chinese population.
26163462 2015 Experimental validation of candidate schizophrenia gene CALN1 as a target for microRNA-137.
26116628 2015 Alternative splicing, expression and cellular localization of Calneuron-1 in the rat and human brain.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19338761 2009 Membrane targeting of the EF-hand containing calcium-sensing proteins CaBP7 and CaBP8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...