Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.47
PubTator Score 10.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.800 1.2e-05
aldosterone-producing adenoma 1.106 3.6e-02
astrocytic glioma -1.400 6.7e-03
Astrocytoma, Pilocytic -3.200 3.0e-06
atypical teratoid / rhabdoid tumor -2.300 1.1e-03
ependymoma -3.800 4.4e-19
glioblastoma -2.900 4.5e-08
group 3 medulloblastoma -4.500 9.2e-07
medulloblastoma, large-cell -2.600 7.0e-04
oligodendroglioma -1.200 3.8e-06
ovarian cancer 1.400 9.0e-09
primitive neuroectodermal tumor -2.700 6.7e-03
subependymal giant cell astrocytoma -3.689 2.2e-02

Gene RIF (7)

AA Sequence

MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY      1 - 70
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHIL     71 - 140
YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA    141 - 210
NQILRSGME                                                                 211 - 219
//

Text Mined References (21)

PMID Year Title