Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.18
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
breast carcinoma 1,614

Gene RIF (1)

PMID Text
25749565 FTHL17 encodes a ferritin-like protein without ferroxidase activity. Its restricted embryonic expression and partial nuclear localization suggest that this novel ferritin type may have functions other than iron storage.

AA Sequence

MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKL      1 - 70
MRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEKGDPQLCHFLESHYLH     71 - 140
EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKET                               141 - 183
//

Text Mined References (8)

PMID Year Title
25749565 2015 The Ferritin-Heavy-Polypeptide-Like-17 (FTHL17) gene encodes a ferritin with low stability and no ferroxidase activity and with a partial nuclear localization.
19812237 2010 Severe XIST hypomethylation clearly distinguishes (SRY+) 46,XX-maleness from Klinefelter syndrome.
16929165 2006 Expression of cancer-testis antigens as possible targets for antigen-specific immunotherapy in head and neck squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14531651 2003 Molecular and cytogenetic characterization of two azoospermic patients with X-autosome translocation.
12704671 2003 Five new human cancer-germline genes identified among 12 genes expressed in spermatogonia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.