Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33
PubTator Score 0.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.202 1.6

Synonym

Accession Q9BXU3 B1B1G8 Q32NB6
Symbols

Gene

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
11279525 Tex13a was identified as a spermatagonia-specific gene in mouse.

AA Sequence

MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEKVEDKLRAILEDSEVPSEVKEACTWG      1 - 70
SLALGVRFAHRQAQLQRHRVRWLHGFAKLHKSAAQALASDLKKLREQQETERKEAASRLRMAQTSLVEVQ     71 - 140
KERDKELVSPHEWEQGAGWPGLATAGGVCTEGAAEEEEEAAVAAAGAAGGKGAEEEQRDVEVVAAPVEAM    141 - 210
APPVEAGAAPMETQFPHVEARAASMETTEKLERILLQLLGDADQEKYTYWGQKEGDLRSVETATSYFSGT    211 - 280
TNPWSRASSEPLPVQLPASYSYSYSSPFSSFSDIPTISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPH    281 - 350
RIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDCGKGIWLQKPH               351 - 409
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14531651 2003 Molecular and cytogenetic characterization of two azoospermic patients with X-autosome translocation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.